SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300521 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300521
Domain Number 1 Region: 31-314
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.94e-72
Family FCH domain 0.00000047
Further Details:      
 
Domain Number 2 Region: 579-640
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000328
Family SH3-domain 0.002
Further Details:      
 
Domain Number 3 Region: 387-458
Classification Level Classification E-value
Superfamily HR1 repeat 0.00000994
Family HR1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300521   Gene: FBgn0035533   Transcript: FBtr0308201
Sequence length 644
Comment pep:known chromosome:BDGP5:3L:4322672:4364102:-1 gene:FBgn0035533 transcript:FBtr0308201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALLASGSSRSSSNNKLAESENSAQNSNNMSWGTELWDQNENLAIHTNRGIDALDKFAN
FLRDRVAIETEYAGKLRRLVKNYQPKKKEEEDNEFTSVQAFRNLLKEVGDLAGQREVVSE
SLQLQIIAGVTLLSKTLREERKKCLSDGATLQQNLTTQLSSLDRAKRNYEKAYRDSEKAV
DSYKRADMDLNLSRAEVERYKNVMTSKIQQSDDAKNEYANQLQKTNNLQQQHYSMLLPSV
LNRLQELDEKRTRGFREFIVGAADVESSVAPIIARCMEGIVKAGESINEKEDTFKVIERY
QSGFTPPRDIPFEDLSKCDPDSVQDSHYSNSTSNHLTIRGTMSANKLKKRVGIFNIFGSN
KQRQIIEACITMKNSLTADGQKEDFSDLPPNQRRKKLQAKIAELTQNIAQETKARDGLMK
MKIVYEANSSLGNPMTVEGQLNESEHKLEKLKVDLKKYQGFLEKASQVPTATSSPQASRN
QLQNGHRTSRHSNGSADDHHDDGDDQPDDAGSLSRSDSEDNVAQIQNGHNNNNNGSSASP
ESGLGTSHTSLPGSGQGSANENAIGEDTYYETEVETLNPVGKCRALYPFEASSEGSIPMS
EGEELQVIEIDQGDGWTRVRRENNSNGWDEGFVPTSYIEITLYA
Download sequence
Identical sequences M9ND42
FBpp0300521 NP_001246616.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]