SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300561 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300561
Domain Number 1 Region: 12-132
Classification Level Classification E-value
Superfamily TPR-like 7.59e-22
Family Tetratricopeptide repeat (TPR) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300561   Gene: FBgn0034692   Transcript: FBtr0308241
Sequence length 267
Comment pep:known chromosome:BDGP5:2R:17973287:17976084:-1 gene:FBgn0034692 transcript:FBtr0308241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKKPKVDTLEEIETNIKLLCDQSNNHMKVRAYEKALFGYNQALELNSTDINALISRSK
CYLLLGEASKALQDAETALGEDKNNIRAIYQKAESLYYLGQFEQSLMFFHRGLRARPELA
LFRLGVQKTQEAIENTIGSKPGPPGPTASVPKSGKSRKSGEDTPKSQAAGATGTSARTRQ
KPSRADLERRNARKLLGELCVDKEYLEKLLLHPDLVRADTHTESISAYAREAVEFLNKRQ
EFWRQQRPCTALPNHKNLPHDALPKWF
Download sequence
Identical sequences A0A0J9RIK8 D6W4X6
FBpp0300561 NP_001246455.1.81976 XP_016029017.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]