SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300573 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300573
Domain Number 1 Region: 2252-2553
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.47e-64
Family Tandem AAA-ATPase domain 0.0000775
Further Details:      
 
Domain Number 2 Region: 1977-2250
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.28e-58
Family Tandem AAA-ATPase domain 0.000036
Further Details:      
 
Domain Number 3 Region: 4389-4445
Classification Level Classification E-value
Superfamily BRK domain-like 1.57e-17
Family BRK domain-like 0.00061
Further Details:      
 
Domain Number 4 Region: 1926-1994
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000393
Family Chromo domain 0.0047
Further Details:      
 
Domain Number 5 Region: 1859-1919
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000187
Family Chromo domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300573   Gene: FBgn0086902   Transcript: FBtr0308253
Sequence length 5343
Comment pep:known chromosome:BDGP5:2L:210735:250823:-1 gene:FBgn0086902 transcript:FBtr0308253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGNAQNMFHGNHQGDPYYRYDAAAAAAAAAAANPRAMGPPGGYPPRHRPPHPLQQQPQY
PSYQPTAENLYGLGAADHQAAMGLGVGVGVGAGMGDLSGWGAAPSVPGQAAAYPGAGLGA
YGHPQAAPPSQQQRQSNASAYRQHMPAYGQQDQQKLASYGAQQSMMAGYGSLAPQQQQQQ
QPPTPQQQQQAQQVQQQAQQQQQQQQQQSQQQARLPQHYPQAPGQHPLYPGVGAPTVQAG
QPPTPQAYAHSPYGSPMQHQPSRGAPQHVGYGHTGLDQASAYGQHVPGGAPPGHHLSAQQ
QQAAQQLGAHQQQQLQSQQQQQAQQQQPHVSLMQQQQLPGAGLPPPHMGMPPSYGSHHQQ
QQQQQQTQQQQQQSAPPYMSSSKHQQAAAQLNSSPQYRAPFPQLSPQMSPRPPTMSPHPQ
MSPRPVGVSPAKPPPPQQQQQQTQAQQPQQVVSNQPSQHSIQGMVGLPSPRPQPPTSGAG
GAGAKGPAPVAAPVNTLQALEQMVMPSQALGLPPMDYPSAYRSAVGPRMPASPQQQQQQH
QQWGAAHGAQHLAALQQQQAQQQQQQVQQQQQAPPQQQQQAAMLQAQQQHHQQQLSMYGQ
PMGQQPQTAQQQVVPPVTSQPPVVAASQQQQQQQHQQQSLNDQLQHSINDIVGGGNSSGA
TGGAQNQHQQQPQLAAMSSPLHQQNLPNMHHLIQPTMETTQPTQQQQQTSQQQQQPQQPQ
ATLTSPHHQQMQHQSPIHQQQQSPHHQQHLPSYNQSQQQFDPFANILGDNQPAASQQTMS
PAHVSSPVPAQMQQQQHQTQQQPSQQVPQSQQQQVSQPQQQTQQQQPSTPSHHLSSILNE
TANSNDSSTLAVAANDSNNSSSNSSTNSIVNNQPTSVHDSNSQSSINSSSNNQQQLLMDN
TNSHGGNSESAQNAGVDVGLFDNNSMSSNSAAVAAVASNAASAAAALLDSNSQSSNAEFE
KNQSEGEGLGVVEGVIANETDLPQDENSVSKTQDITLSTELPTIQDDLQEKPTAEMEQTQ
LGQSLGDLSKSLLEEPKTVEESGEDKSQSAPGVAPPADPIIPVTQPPQQQMPPIGMPMHP
IAPGYEAQAQGQGHMPPMMPPYGGAPGMYPPYPMLHQQEIAALQQQIQELYCMPPGHELQ
HQDKLMRMQERLNLLTQHEVNDQCAGGPQCLLFQNVPPMYGPPGNPLLNQQMVESPQVSS
TTGRGRGKSANKPRKPRAKKGEKAQVGQQQDLMDISGNVAMGAANAVSSIPTTQLPVSED
CVTQGAGDTSVVGMLEYSEGMGDLSQDVHSANELDTSTDGSGKKKKPRKPRTPKDPNKPP
RDRTPKAKKPKDPNDPNSTETPAAVKKRAGASKRRKQYGEDGAEQTGEGSEVEDNKPLVP
KAGSADGEAETTSGGTGVDGESPDYDDIPVSKIPRGSNEDEKEAEAGDETVDSVPDSAGD
PASTPSRRDRKRSTARSRRNANSEEGGSARKNRGSLSAKALKKRRNRGRIVPESDGEDDT
LDRTPPPSPPPDSEMDSNKRRSSRNTQRKKYIDDVMLRFSDDENSLLVASPVKKDKKPSA
NASNSNAGSDVEKTEPQSGAEGDAAQEVGEEKSNLPLDESSQLEASSSTSAVAEKERQIS
TDAANAAMSSKPNYVYINTGDEDSMVVQLVLAMRMGKRELILDKPKEKAPEPKQDEEKSE
LDEATTDKPEGDEKFKTEGESKKDLTDSEETKLESSAMEVDSKEESEPDDSKKSDEDNKD
KDKMEVDDEVGKSDKESKPEEQSETVKTEENSKAIEEDKSSTVLTADHAKEPETVLEKME
VDEKANDDQSAVSKAEGSDEKSTDDSNPEEATTEKNKESLEIEGEKERVKEGEESVKKEN
DEKTEADMENKPEPVFIDVEEYFVKYRNFSYLHCEWRTEEELLKGDRRVAAKIRRFQQKQ
SQQLNIFENIEDEPFNQDFTEVDRVLDMSVHTDETSGETTKHYLVKWKSLPYEDCTWELE
EDVDNDKIEQYLRFNKIPQRSEWKSKKRPHPELWKKLEKTPVYKGGNSLRPYQLEGLNWL
KFSWYNTHNCILADEMGLGKTIQSLTFVHSVYEYGIRGPFLVIAPLSTIPNWQREFEGWT
DMNVVVYHGSVTSKQMIQDYEYYYKTESGKVLKEPIKFNVLITTFEMIVTDYMDLKAFNW
RLCVIDEAHRLKNRNCKLLEGLRQLNLEHRVLLSGTPLQNNISELFSLLNFLEPSQFSSQ
EEFMSEFGSLRTEEEVNKLQALLKPMMLRRLKDDVEKSLAPKEETIIEVELTNIQKKYYR
GILEQNFSFLKKGTTSANIPNLMNTMMELRKCCIHPYLLNGAEEQIQYDFKSQHGEDPES
YYKNLILSAGKMVLIDKLLPKLKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGRI
RGNLRQEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWNPQNDLQAQARC
HRIGQRKMVKIYRLLCRNTYEREMFDKASMKLGLDKAVLQSMNTQGSKDGNNKQLSKKEI
EDLLKKGAYGAVMDDDNAGDKFCEEDIDSILKRRTQVITMESEKGSTFSKASFAASGNRS
DITIDDPDFWTKWAKKVDIDPDACERDETEDLVLSEPRRRTQIKRYGHEDVMELNSEESS
NENSDEEGGIGLRSRRRKEKRDRAREKKGNDEYIPRERDALAALGLEEIQYGNWAKSECF
KVEKGLLSFGWGRWSELLELGQFKRGWRDVDVEDCARIILLYCLQVYKGDEKIKTFIWDL
ITPTEDGEVQKISRDHSGLHNLVPRGRNAKGRNGGKSNKESTGVSTPAPGSASGSNSGNT
TPAHKSSALDGSDKDSGGINASAVAAAVTSIHDPNHWSKKEKYDADAYLEGAYKKHLGRH
ANKVLLRVRMLYYIQHEVIGDFVQQIKDNTPISSTRAKQQLALNLNLESELPIRPPPTPD
QVPSSWWNPICCDKSLLVGTYKHGCEMYRQMRADPNLCFVTHVGAGAAGDDLAVTSLPIN
EDDANSKHDDGDEVDDDGTTTTKDSDSTKLTGGDNKDSLLDPERPSSSGLDEEESVAGSY
PPTVAAVEDATTMWPSMQDLNTRLRRVITAYQRNYKKEELKLQQKAKLQALVSSTPPLSV
PTTPTLQSMQMQLQSGSGSGGSGIGSSAQHDASGRSLQALMQSQGASTSAAAAAAASSAG
GSCSGSGQVGMGGAGVMPAMPTAADISLMLSILNTTDVNQLANLDINKLAMYLVSMNNKM
ERQGKMELAAKERESQRLQLIPKKWNRREEYEFLRVLTGYGVDLHVSTPMASSNGSSLSP
DWTKFKQMAHLERKSDETLTDYYKVFVAMCKRQAGLKLSESERGLEGIIEEIEKEHAKLI
LDRLEVLAKLREVARNPMLEERLKLCTKNADTPDWWEPGRHDKELITAVLKHGLYRSETF
IFNDPNFSFGESEKRFIRELEAQIQRTIKLEAFNAEKAEKLAAAEKDAATEKAAATEKAA
AEKAASVKNEVIDLDDELMTNESVIKKESPVTPIKEEIKSEESPEKHDTADNLEDKNSDA
EESTKIKGKEDFNPETTEKEALDESTNLNKDKSSTETLVPEIEDSKPSEDKMEVEELPVA
ENGEKEGSPEKCSDAEDKKFSEEKPSSPAVPDGKVSEMEADEAAPNTEENCSGDSESPEK
ECEDKVVEKVEEEKGENSYEKAEEQKEETEKLEKSSIESEPSEKSETVLEPEVAVPKKST
GDQDILDLVAGPSDPDDDEVMKEKEKAVEEECKKQAAELKARFPDLEVIQPATVKQQKLE
KPKLEMCMIRWFKDFALERRIAHIVACVESGNWPVDSKYSAFATCKGATDLSIALHESIP
HLSSLERRSTTPDVITITTDQGVTKHLQTSHMQQVASSASAASTSSGVPQVTQSKPSSSN
SLPGLDAKSINAAVAAAVAAAAAGGNATSLSSLLPGMSLSAATGSSAGGVSGLSVPSAGS
GVGKKRKRHIAIDVETERAKLHALLNSSTMAPKDWESEIANMEALSGSSGRGRGGNSSAS
SGMQPPPAHQHASLSRQSSGQFSKPAVPAMKTPPPSMGAPMDLSSSLPKMNMTEMLKSAS
SSGAIDLSEVQDFSMPSKKSSVHAALSSAFPSMGNKSKLDDTLNKLMKKNNCTIEEPVIG
KEKKRKKLDEIVLGLSAAKEQKTFPDPSLPSSKKPQIPPSVSVTPANLQSSSNQQSNQKP
FTITVTTVPGKSKSGSSNSGSGTGGSSSASGGGAGGSGLSALQNMAMGGLSSKDSLNALL
AQTMATDPQTFLKQQQKMMQFLPPAQRKAYENMLAEMEQAMKISSKFSTNSPHDVKVNKW
LSDMTSPLGDQLSIDYVGGGGASGSGSGNSRRSNRQQGNSQQSSSAAQLQKQQQQQQQQQ
QQQQQHSMPGPQNLTGEEPVPVINKQTGKRLGGNKAPQLKRLMQWLTENPNYEVDPKWLE
QMQNPMSTPSPRPASMESGYGSSAVKSHGGRPLSNLSSTSSSSHTQQQSSAAQSQAGGNS
GSSKKNSRQQTAASAALDQAALQFGSLAGLNPSLLANLPGLGAFDPKNPLAAFDPKNPLL
SMSFGGMPGMGNIPGLGNLNNMNLFASLAGMGGLGNLAGMDTQSLAALMAAAGPTLGGLT
GASGGAGSGKSQAQSQSSATSSSSSASKKKQQQQQQQAQNEAAQLAAAISASTGGSGASG
GKNAAASASQLAAGFPFLFPNPSLLYPPMGLGGLNPYSLGSSGLGSAYDQLAQQYNLLNG
ATSSASNTSSTQSKSHQSQSKSSQSRNTTASANSAASLMNAMASMGGGASTVTTPSTSAS
GSGRGRQSSSRNQSQTTPTAADMAQLSSLLMPGADPHLLESLSRMSNMDLAQATRLMSSL
GMPPLSGTPSSSGGGNTSTSKRSSQAANEANVQAKEQQKWLESLARGALPTDLAALQAFS
QGKMPSTSGSNTGTSTSSSKSSKAAATAAAAQLPQIPGMSSDFPQAFLAEMAAQAMAAAG
GSLPLSGPGSLASLAGLTGGSAGGGGSSASGSTSHSSSKRQREQDAFKQQMDYYTKTLGL
GSGISLIPTSSAGGSSASSSAANAAAAAYAAALDAEQQHQQQQKALSKRARGDLHPTKEE
LAALAAGLPLNLGASMSSIEKSLRGGSSSSSSSTPAPMTAEQDKVTLTPLNASGGGSGSS
SSSAAAAGLAANLPSQTTITIAPPISSGASTSSERSERSESRISLTITNAADAAKLPPPY
EEADELIIQPILKKPTAANPGSSHGGSVDDLDTAENTSAANLSGSSSSSAAAAAAAAAEE
NRRSSNRLKRPRSGNEQGSGSVEGQPPEKRRELRSTRHTRSSADASTLNLSTGSESGAEE
RNE
Download sequence
Identical sequences M9NCY5
FBpp0300573 NP_001245818.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]