SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300803 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300803
Domain Number 1 Region: 15-151
Classification Level Classification E-value
Superfamily EF-hand 3.36e-37
Family Calmodulin-like 0.0000608
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300803   Gene: FBgn0004687   Transcript: FBtr0308579
Sequence length 153
Comment pep:known chromosome:BDGP5:X:5513169:5514560:-1 gene:FBgn0004687 transcript:FBtr0308579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYYYTAHVKQTFTTLEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQ
LKPDERISFEVFLPIYQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGE
KLTDEEVEQLLANMEDQQGNINYEEFVRMVMSG
Download sequence
Identical sequences A0A0Q5T2T4 A0A0R1E9Y6 M9NEW1
FBpp0300803 NP_001245533.1.81976 XP_015010939.1.56816 XP_015045517.1.41174 XP_016038192.1.80810 FBpp0300803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]