SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300825 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0300825
Domain Number - Region: 316-377
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0317
Family Ubiquitin-related 0.01
Further Details:      
 
Domain Number - Region: 136-213
Classification Level Classification E-value
Superfamily TPR-like 0.0898
Family Tetratricopeptide repeat (TPR) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300825   Gene: FBgn0039616   Transcript: FBtr0308601
Sequence length 458
Comment pep:known chromosome:BDGP5:3R:24748766:24750808:1 gene:FBgn0039616 transcript:FBtr0308601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLLQIEDELIGYMRQYAMELQHKVNTMRTFQEEWMTRRALGPADPTSYVANPLISFPL
MRRTYTDVPKLLELAREEFKPGPFQKFIDYDLSSISDVELETAVTGMLRFQGVYGMDESE
MANGKLHGKQYNSRMSAADCLAVATHLENVDKGKLACKWFKVAIDQYEEKLDPVNRLLQT
GRSQIYEKLGLTLLAMHDLPASQAAFRDSIGWASKEDNTDLAKHLKDKLAHMFVHVDNCR
GKNLLPSKSYLRCRYLRDGSPFLRMAPVKLEQLNIEPFVGLFHDAISPAEQKDLLHLTDS
RLEHRKKDSSSVEAKVDTNASDHVRRIHQRIEDITGFDLEESEPLTVSNYGIGGQDFIHL
DCEQPKEFIGYYPKEYRSASAMFYLSDVQMGGYASFPDLGFGFKPRRGSALVWHNTDNSG
NCDTRSLQATCPVLLGNQWVAKKWISGSGQWRRKSCRK
Download sequence
Identical sequences Q9VAR7
FBpp0300825 NP_651648.5.81976 FBpp0300825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]