SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300837 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300837
Domain Number 1 Region: 15-133
Classification Level Classification E-value
Superfamily EF-hand 8.16e-35
Family EF-hand modules in multidomain proteins 0.0037
Further Details:      
 
Domain Number 2 Region: 134-227
Classification Level Classification E-value
Superfamily EF-hand 9.07e-26
Family EF-hand modules in multidomain proteins 0.012
Further Details:      
 
Domain Number 3 Region: 209-291
Classification Level Classification E-value
Superfamily RING/U-box 5.89e-19
Family ZZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300837   Gene: FBgn0033739   Transcript: FBtr0308613
Sequence length 702
Comment pep:known chromosome:BDGP5:2R:8324840:8340421:1 gene:FBgn0033739 transcript:FBtr0308613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEPRVAILQDLRLQTFDSIRFASYRTASKLRYIQKSTNLHLVDIWNVIEAFRENGLNT
LEPQSEVSVARLETLVSSLYHNLNKRLPTAQQVPVDSKAGLLLNWLLAAYTSDNSGKIRV
FSIKVALATMCSGKLVDKLRYIFSQISDGAGQLVAWKLGEFLREVLALPAAVYESPTFHY
KEGLEEEIFPAENKVTVNDFMATLMSEPGPSCLVWLPLVHRLATVETIVHPTVCSVCHKE
NFTGFRYRCQRCHAYQLCQECFWHGKTSLNHQNDHEVKEYSSYKSPSKQIGHSLRKSFRC
VPEKTVQVLPRFPDQPEKTLNLSHIVPPSPLPSHNGFSDPSGLVHGHHGPHPGLPGQHGL
FDRSSTLDSRATGRSLDSASGTAGTTMSRVAAASANDEEHRLIARYAARLAQENRAPSNL
PDNATPIGTDNSRAQRELIAQLESKNKEIMREIARLRRQQETEQMAPENPALINELRALR
QRKGELEGHLGALQDSRRQLMEQLEGLMRMLKNQQTASPRSTPNSSPRSGKSPPMPGGAG
ILGTSPMSALHAQQMQQHPMAGGVRASQQQLLQQQQQQAHGHGPFSQSQLEQLNQISSDM
RSAFAANGSATPPPMRTTTATANVSAIPSLNPISNQNPNLNPDAELNEAADHLTSAISHM
VSDLNADFDESQSYNQEWNEKANANSQWQEQFAQWSLNSQKN
Download sequence
Identical sequences A1Z907
NP_001027407.2.81976 FBpp0300837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]