SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300845 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300845
Domain Number 1 Region: 98-393
Classification Level Classification E-value
Superfamily L domain-like 7.57e-63
Family Internalin LRR domain 0.024
Further Details:      
 
Domain Number 2 Region: 1139-1235
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-25
Family PDZ domain 0.004
Further Details:      
 
Domain Number 3 Region: 716-819
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-24
Family PDZ domain 0.00097
Further Details:      
 
Domain Number 4 Region: 1236-1334
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-22
Family PDZ domain 0.00033
Further Details:      
 
Domain Number 5 Region: 10-122
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 1.96e-21
Family Outer arm dynein light chain 1 0.0096
Further Details:      
 
Domain Number 6 Region: 926-1029
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-21
Family PDZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300845   Gene: FBgn0263289   Transcript: FBtr0308621
Sequence length 1756
Comment pep:known chromosome:BDGP5:3R:22362072:22421910:1 gene:FBgn0263289 transcript:FBtr0308621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKCIPIFKGCNRQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLH
RLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPK
LPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRL
DLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEI
SGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN
FLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTV
LHVLDVSGNQLLYLPYSLVNLQLKAVWLSENQSQPLLTFQPDTDAETGEQVLSCYLLPQQ
EYQPITPARDLESDSEPFEEREPSRTVVKFSEEATQEKETPFVRQNTPHPKDLKAKAQKL
KVERSRNEEHANLVTLPEENGTKLAETPTETRTIANNHQQQPHPVQQPIVGVNSKQPVVV
GVVTPTTTTVAPTGVQGGSEGASSTANNVKAATAAVVAELAATVGGSDEVQDDDEQEDEF
ESDRRVGFQVEGEDDDFYKRPPKLHRRDTPHHLKNKRVQHLTDKQASEILANALASQERN
DTTPQHSLSGKVTSPIEEEEQLEVEQEQQQQQQQHPFDSSLSPISAGKTAEASTDPDNLD
GVTELRLEQYEIHIERTAAGLGLSIAGGKGSTPFKGDDDGIFISRVTEAGPADLAGLKVG
DKVIKVNGIVVVDADHYQAVQVLKACGAVLVLVVQREVTRLIGHPVFSEDGSVSQISVET
RPLVADAPPAASISHERYIPAPIEIVPQQQHLQQQQQQPIQQVAPTHSYSGNVFATPTAA
QTVQPAVSAAPNGLLLNGREAPLSYIQLHTTLIRDQIGQGLGFSIAGGKGSPPFKDDCDG
IFISRITEGGLAYRDGKIMVGDRVMAINGNDMTEAHHDAAVACLTEPQRFVRLVLQREYR
GPLEPPTSPRSPAVLNSLSPSGYLANRPANFSRSVVEVEQPYKYNTLATTTPTPKPTVPA
SISNNNNTLPSSKTNGFATAAAATIDSSTGQPVPAPRRTNSVPMGDGDIGAGSTTSGDSG
EAQEVVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRIL
KVNEADVSKATHQDAVLELLKPGDEIKLTIQHDPLPPGFQEVLLSKAEGERLGMHIKGGL
NGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRN
AGNEIQLVVCKGYDKSNLIHSIGQAGGMSTGFNSSASCSGGSRQGSRASETGSELSQSQS
VSSLDHEEDERLRQDFDVFASQKPDAQQPTGPSVLAAAAAMVHGASSPTPPAATSNITPL
PTAAAVASADLTAPDTPATQTVALIHAEQQAHQQQQQTQLAPLGQEKSTQEKVLEIVRAA
DAFTTVPPKSPSEHHEQDKIQKTTTVVISKHTLDTNPTTPTTPAAPLSIAGAESANSAGA
PSPAVPASTPGSAPVLPAVAVQTQTQTTSTEKDEEEESQLQSTPASRDGAEEQQEEVRAK
PTPTKVPKSVSDKKRFFESAMEDQHKPTQKTDKVFSFLSKDEVEKLRQEEERKIATLRRD
KNSRLLDAANDNIDKDAAQQRTKSNSNSSSGDDNDDSDQEEGIARGDSVDNAALGHFDDA
EDMRNPLDEIEAVFRS
Download sequence
Identical sequences U3RC96
FBpp0300844 FBpp0300845 NP_001036761.3.81976 NP_733154.1.81976 FBpp0291304 FBpp0291305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]