SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300846 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300846
Domain Number 1 Region: 9-283
Classification Level Classification E-value
Superfamily L domain-like 2.04e-58
Family Internalin LRR domain 0.0042
Further Details:      
 
Domain Number 2 Region: 237-393
Classification Level Classification E-value
Superfamily L domain-like 1.09e-29
Family Internalin LRR domain 0.025
Further Details:      
 
Domain Number 3 Region: 1324-1417
Classification Level Classification E-value
Superfamily PDZ domain-like 1.29e-24
Family PDZ domain 0.0044
Further Details:      
 
Domain Number 4 Region: 808-908
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-24
Family PDZ domain 0.00097
Further Details:      
 
Domain Number 5 Region: 1419-1517
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-22
Family PDZ domain 0.00033
Further Details:      
 
Domain Number 6 Region: 1015-1118
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-21
Family PDZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300846   Gene: FBgn0263289   Transcript: FBtr0308622
Sequence length 1939
Comment pep:known chromosome:BDGP5:3R:22362072:22420740:1 gene:FBgn0263289 transcript:FBtr0308622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKCIPIFKGCNRQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLH
RLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPK
LPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRL
DLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEI
SGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN
FLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTV
LHVLDVSGNQLLYLPYSLVNLQLKAVWLSENQSQPLLTFQPDTDAETGEQVLSCYLLPQQ
EYQPITPARDLESDSEPFEEREPSRTVVKFSEEATQEKETPFVRQNTPHPKDLKAKAQKL
KVERSRNEEHANLVTLPEENGTKLAETPTETRTIANNHQQQPHPVQQPIVGVNSKQPVVV
GVVTPTTTTVAPTGVQGGSEGASSTANNVKAATAAVVAELAATVGGSDEVQDDDEQEDEF
ESDRRVGFQVEGEDDDFYKRPPKLHRRDTPHHLKNKRVQHLTDKQASEILANALASQERN
DTTPQHSLSGKVTSPIEEEEQLEVEQEQQQQQQQHPFDSSLSPISAGKTAEASTDPANQA
MFNVKIKVKEGNNTLPRNGQRSNGNFSYSGAGSGRNSPAMSSLRSSLASSNRSPSGSLQR
KGKRVRIVTSYDPIDRDYERQRQHYDNLDGVTELRLEQYEIHIERTAAGLGLSIAGGKGS
TPFKGDDDGIFISRVTEAGPADLAGLKVGDKVIKVNGIVVVDADHYQAVQVLKACGAVLV
LVVQREVTRLIGHPVFSEDGSVSQISVETRPLVADAPPAASISHERYIPAPIEIVPQQQH
LQQQQQQPIQQVAPTHSYSGNVFATPTAAQTVQPAVSAAPNGLLLNGREAPLSYIQLHTT
LIRDQIGQGLGFSIAGGKGSPPFKDDCDGIFISRITEGGLAYRDGKIMVGDRVMAINGND
MTEAHHDAAVACLTEPQRFVRLVLQREYRGPLEPPTSPRSPAVLNSLSPSGYLANRPANF
SRSVVEVEQPYKYNTLATTTPTPKPTVPASISNNNNTLPSSKTNGFATAAAATIDSSTGQ
PVPAPRRTNSVPMGDGDIGAGSTTSGDSGEAQPSSLRPLTSDDFQAMIPAHFLSGGSQHQ
VHVARPNEVGVSAVTVNVNKPQPDLPMFPAAPTELGRVTETITKSTFTETVMTRITDNQL
AEPLISEVVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGD
RILKVNEADVSKATHQDAVLELLKPGDEIKLTIQHDPLPPGFQEVLLSKAEGERLGMHIK
GGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNV
LRNAGNEIQLVVCKGYDKSNLIHSIGQAGGMSTGFNSSASCSGGSRQGSRASETGSELSQ
SQSVSSLDHEEDERLRQDFDVFASQKPDAQQPTGPSVLAAAAAMVHGASSPTPPAATSNI
TPLPTAAAVASADLTAPDTPATQTVALIHAEQQAHQQQQQTQLAPLGQEKSTQEKVLEIV
RAADAFTTVPPKSPSEHHEQDKIQKTTTVVISKHTLDTNPTTPTTPAAPLSIAGAESANS
AGAPSPAVPASTPGSAPVLPAVAVQTQTQTTSTEKDEEEESQLQSTPASRDGAEEQQEEV
RAKPTPTKVPKSVSDKKRFFESAMEDQHKPTQKTDKVFSFLSKDEVEKLRQEEERKIATL
RRDKNSRLLDAANDNIDKDAAQQRTKSNSNSSSGDDNDDSDQEEGIARGDSVDNAALGHF
DDAEDMRNPLDEIEAVFRS
Download sequence
Identical sequences 7227.FBpp0099536 FBpp0291306 NP_001014670.2.81976 FBpp0300846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]