SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300847 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300847
Domain Number 1 Region: 9-283
Classification Level Classification E-value
Superfamily L domain-like 1.59e-58
Family Internalin LRR domain 0.0042
Further Details:      
 
Domain Number 2 Region: 237-393
Classification Level Classification E-value
Superfamily L domain-like 4.59e-30
Family Internalin LRR domain 0.025
Further Details:      
 
Domain Number 3 Region: 716-819
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-24
Family PDZ domain 0.00097
Further Details:      
 
Domain Number 4 Region: 1239-1330
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-24
Family PDZ domain 0.0037
Further Details:      
 
Domain Number 5 Region: 1331-1429
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-22
Family PDZ domain 0.00033
Further Details:      
 
Domain Number 6 Region: 926-1029
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-21
Family PDZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300847   Gene: FBgn0263289   Transcript: FBtr0308623
Sequence length 1711
Comment pep:known chromosome:BDGP5:3R:22362072:22407239:1 gene:FBgn0263289 transcript:FBtr0308623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKCIPIFKGCNRQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLH
RLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPK
LPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRL
DLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEI
SGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN
FLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTV
LHVLDVSGNQLLYLPYSLVNLQLKAVWLSENQSQPLLTFQPDTDAETGEQVLSCYLLPQQ
EYQPITPARDLESDSEPFEEREPSRTVVKFSEEATQEKETPFVRQNTPHPKDLKAKAQKL
KVERSRNEEHANLVTLPEENGTKLAETPTETRTIANNHQQQPHPVQQPIVGVNSKQPVVV
GVVTPTTTTVAPTGVQGGSEGASSTANNVKAATAAVVAELAATVGGSDEVQDDDEQEDEF
ESDRRVGFQVEGEDDDFYKRPPKLHRRDTPHHLKNKRVQHLTDKQASEILANALASQERN
DTTPQHSLSGKVTSPIEEEEQLEVEQEQQQQQQQHPFDSSLSPISAGKTAEASTDPDNLD
GVTELRLEQYEIHIERTAAGLGLSIAGGKGSTPFKGDDDGIFISRVTEAGPADLAGLKVG
DKVIKVNGIVVVDADHYQAVQVLKACGAVLVLVVQREVTRLIGHPVFSEDGSVSQISVET
RPLVADAPPAASISHERYIPAPIEIVPQQQHLQQQQQQPIQQVAPTHSYSGNVFATPTAA
QTVQPAVSAAPNGLLLNGREAPLSYIQLHTTLIRDQIGQGLGFSIAGGKGSPPFKDDCDG
IFISRITEGGLAYRDGKIMVGDRVMAINGNDMTEAHHDAAVACLTEPQRFVRLVLQREYR
GPLEPPTSPRSPAVLNSLSPSGYLANRPANFSRSVVEVEQPYKYNTLATTTPTPKPTVPA
SISNNNNTLPSSKTNGFATAAAATIDSSTGQPVPAPRRTNSVPMGDGDIGAGSTTSGDSG
EAQPSSLRPLTSDDFQAMIPAHFLSGGSQHQVHVARPNEVGVSAVTVNVNKPQPDLPMFP
AAPTELGRVTETITKSTFTETVMTRITDNQLAEPLISEEVVLPKNQGSLGFSIIGGTDHS
CVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKPGDE
IKLTIQHDPLPPGFQEVLLSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGA
ARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCKGYDKSNLIHSIGQA
GGMSTGFNSSASCSGGSRQGSRASETGSELSQSQSVSSLDHEEDERLRQDFDVFASQKPD
AQQPTGPSVLAAAAAMVHGASSPTPPAATSNITPLPTAAAVASADLTAPDTPATQTVALI
HAEQQAHQQQQQTQLAPLGQEKSTQEKVLEIVRAADAFTTVPPKSPSEHHEQDKIQKTTT
VVISKHTLDTNPTTPTTPAAPLSIAGAESANSAGAPSPAVPASTPGSAPVLPAVAVQTQT
QTTSTEKDEEEESQLQVCTHLTVDARLLSWL
Download sequence
Identical sequences FBpp0291307 FBpp0300847 NP_001014669.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]