SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300848 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300848
Domain Number 1 Region: 9-260
Classification Level Classification E-value
Superfamily L domain-like 2.15e-54
Family Internalin LRR domain 0.012
Further Details:      
 
Domain Number 2 Region: 197-395
Classification Level Classification E-value
Superfamily L domain-like 1.7e-37
Family Internalin LRR domain 0.027
Further Details:      
 
Domain Number 3 Region: 716-819
Classification Level Classification E-value
Superfamily PDZ domain-like 9.46e-25
Family PDZ domain 0.00097
Further Details:      
 
Domain Number 4 Region: 926-1029
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-21
Family PDZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300848   Gene: FBgn0263289   Transcript: FBtr0308624
Sequence length 1247
Comment pep:known chromosome:BDGP5:3R:22362072:22402761:1 gene:FBgn0263289 transcript:FBtr0308624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKCIPIFKGCNRQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLH
RLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPK
LPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRL
DLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEI
SGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN
FLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTV
LHVLDVSGNQLLYLPYSLVNLQLKAVWLSENQSQPLLTFQPDTDAETGEQVLSCYLLPQQ
EYQPITPARDLESDSEPFEEREPSRTVVKFSEEATQEKETPFVRQNTPHPKDLKAKAQKL
KVERSRNEEHANLVTLPEENGTKLAETPTETRTIANNHQQQPHPVQQPIVGVNSKQPVVV
GVVTPTTTTVAPTGVQGGSEGASSTANNVKAATAAVVAELAATVGGSDEVQDDDEQEDEF
ESDRRVGFQVEGEDDDFYKRPPKLHRRDTPHHLKNKRVQHLTDKQASEILANALASQERN
DTTPQHSLSGKVTSPIEEEEQLEVEQEQQQQQQQHPFDSSLSPISAGKTAEASTDPDNLD
GVTELRLEQYEIHIERTAAGLGLSIAGGKGSTPFKGDDDGIFISRVTEAGPADLAGLKVG
DKVIKVNGIVVVDADHYQAVQVLKACGAVLVLVVQREVTRLIGHPVFSEDGSVSQISVET
RPLVADAPPAASISHERYIPAPIEIVPQQQHLQQQQQQPIQQVAPTHSYSGNVFATPTAA
QTVQPAVSAAPNGLLLNGREAPLSYIQLHTTLIRDQIGQGLGFSIAGGKGSPPFKDDCDG
IFISRITEGGLAYRDGKIMVGDRVMAINGNDMTEAHHDAAVACLTEPQRFVRLVLQREYR
GPLEPPTSPRSPAVLNSLSPSGYLANRPANFSRSVVEVEQPYKYNTLATTTPTPKPTVPA
SISNNNNTLPSSKTNGFATAAAATIDSSTGQPVPAPRRTNSVPMGDGDIGAGSTTSGDSG
EAQPSSLRPLTSDDFQAMIPAHFLSGGSQHQVHVARPNEVGVSAVTVNVNKPQPDLPMFP
AAPTELGRVTETITKSTFTETVMTRITDNQLAEPLISEVTISTSRIH
Download sequence
Identical sequences NP_733156.1.81976 FBpp0291308 FBpp0300848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]