SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300851 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300851
Domain Number 1 Region: 112-393
Classification Level Classification E-value
Superfamily L domain-like 1.61e-59
Family Internalin LRR domain 0.029
Further Details:      
 
Domain Number 2 Region: 5-169
Classification Level Classification E-value
Superfamily L domain-like 6.12e-30
Family Internalin LRR domain 0.032
Further Details:      
 
Domain Number 3 Region: 1139-1235
Classification Level Classification E-value
Superfamily PDZ domain-like 5.91e-25
Family PDZ domain 0.004
Further Details:      
 
Domain Number 4 Region: 716-819
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-24
Family PDZ domain 0.00097
Further Details:      
 
Domain Number 5 Region: 1236-1334
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-22
Family PDZ domain 0.00033
Further Details:      
 
Domain Number 6 Region: 926-1029
Classification Level Classification E-value
Superfamily PDZ domain-like 4.2e-21
Family PDZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300851   Gene: FBgn0263289   Transcript: FBtr0308627
Sequence length 2331
Comment pep:known chromosome:BDGP5:3R:22362072:22429773:1 gene:FBgn0263289 transcript:FBtr0308627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKCIPIFKGCNRQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLH
RLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPK
LPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRL
DLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEI
SGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN
FLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTV
LHVLDVSGNQLLYLPYSLVNLQLKAVWLSENQSQPLLTFQPDTDAETGEQVLSCYLLPQQ
EYQPITPARDLESDSEPFEEREPSRTVVKFSEEATQEKETPFVRQNTPHPKDLKAKAQKL
KVERSRNEEHANLVTLPEENGTKLAETPTETRTIANNHQQQPHPVQQPIVGVNSKQPVVV
GVVTPTTTTVAPTGVQGGSEGASSTANNVKAATAAVVAELAATVGGSDEVQDDDEQEDEF
ESDRRVGFQVEGEDDDFYKRPPKLHRRDTPHHLKNKRVQHLTDKQASEILANALASQERN
DTTPQHSLSGKVTSPIEEEEQLEVEQEQQQQQQQHPFDSSLSPISAGKTAEASTDPDNLD
GVTELRLEQYEIHIERTAAGLGLSIAGGKGSTPFKGDDDGIFISRVTEAGPADLAGLKVG
DKVIKVNGIVVVDADHYQAVQVLKACGAVLVLVVQREVTRLIGHPVFSEDGSVSQISVET
RPLVADAPPAASISHERYIPAPIEIVPQQQHLQQQQQQPIQQVAPTHSYSGNVFATPTAA
QTVQPAVSAAPNGLLLNGREAPLSYIQLHTTLIRDQIGQGLGFSIAGGKGSPPFKDDCDG
IFISRITEGGLAYRDGKIMVGDRVMAINGNDMTEAHHDAAVACLTEPQRFVRLVLQREYR
GPLEPPTSPRSPAVLNSLSPSGYLANRPANFSRSVVEVEQPYKYNTLATTTPTPKPTVPA
SISNNNNTLPSSKTNGFATAAAATIDSSTGQPVPAPRRTNSVPMGDGDIGAGSTTSGDSG
EAQEVVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRIL
KVNEADVSKATHQDAVLELLKPGDEIKLTIQHDPLPPGFQEVLLSKAEGERLGMHIKGGL
NGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRN
AGNEIQLVVCKGYDKSNLIHSIGQAGGMSTGFNSSASCSGGSRQGSRASETGSELSQSQS
VSSLDHEEDERLRQDFDVFASQKPDAQQPTGPSVLAAAAAMVHGASSPTPPAATSNITPL
PTAAAVASADLTAPDTPATQTVALIHAEQQAHQQQQQTQLAPLGQEKSTQEKVLEIVRAA
DAFTTVPPKSPSEHHEQDKIQKTTTVVISKHTLDTNPTTPTTPAAPLSIAGAESANSAGA
PSPAVPASTPGSAPVLPAVAVQTQTQTTSTEKDEEEESQLQSTPASRDGAEEQQEEVRAK
PTPTKVPKSVSDKKRFFESAMEDQHKPTQKTDKVFSFLSKDEVEKLRQEEERKIATLRRD
KNSRLLDAANDNIDKDAAQQRTKSNSNSSSGDDNDDSDQEEGIARGDSVDNAALGHFDDA
EDMSAEKRASWRAARLRSLEQGAVEAQDVIKNMRKMTDDLITHESRASEVETCKERIISL
ELQVPETEDEGKLDDTQPPLELEADDFQDDEDDDDDDDDEDDFEDEDEEEDTASIVTVQA
NNEKLFLRHDSDTYGPSSIESVASGKVRIKPTPLSLHQTLAKETTIVEVLNPVIGGDGSA
RTIHVSGGLPFDEDAFEQGAVAVLRSETFVLPGAAGGGRSELSLNAKMKTVLEELLENER
VKLNLQKSLEGEEGEDDDDEDENGSAYGDARDEEESAYGDAIDDVVDFGSATVTSRAAND
KDDVKNGNQQLLEELIKDSNRNTIIAKLAGQLSDDDEEDDDEEESSDSSDDDSDDSDEED
NAQQQLNVTYVQGAQVIENLNTLATGGKLQKSQTYTAIKQAEEPKEEDTKLEEDPSAEKP
CGADTLAKLQAEQRALAEISKQLRKSVEDLLSADGETVVETQRTYTLPAPSDSSAVVTVT
EVVKKQKKKKSETGEELFNRLLNAAESERQVFDRQQGETITTTTTTTEAVSSEDNEPSTS
VVTTTRTVSNIVTSGIPRPETSKQNNRSSSSSNSNSSNNNRNKNKRKGKKK
Download sequence
Identical sequences FBpp0300851 FBpp0291311 NP_001247318.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]