SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300854 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300854
Domain Number 1 Region: 19-391
Classification Level Classification E-value
Superfamily L domain-like 3.51e-75
Family Internalin LRR domain 0.0081
Further Details:      
 
Domain Number 2 Region: 741-844
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-24
Family PDZ domain 0.00097
Further Details:      
 
Domain Number 3 Region: 1264-1354
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-24
Family PDZ domain 0.0037
Further Details:      
 
Domain Number 4 Region: 1356-1454
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-22
Family PDZ domain 0.00033
Further Details:      
 
Domain Number 5 Region: 951-1054
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-21
Family PDZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300854   Gene: FBgn0263289   Transcript: FBtr0308630
Sequence length 2554
Comment pep:known chromosome:BDGP5:3R:22362072:22414423:1 gene:FBgn0263289 transcript:FBtr0308630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKCIPIFKGCNRQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLH
RLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPK
LPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRL
DLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEI
SGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN
FLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTV
LHVLDVSGNQLLYLPYSLVNLQLKAVWLSENQSQPLLTFQPDTDAETGEQVLSCYLLPQQ
EYQPITPDYPPMTLYRSSEKFDSTEFFSYQQKARDLESDSEPFEEREPSRTVVKFSEEAT
QEKETPFVRQNTPHPKDLKAKAQKLKVERSRNEEHANLVTLPEENGTKLAETPTETRTIA
NNHQQQPHPVQQPIVGVNSKQPVVVGVVTPTTTTVAPTGVQGGSEGASSTANNVKAATAA
VVAELAATVGGSDEVQDDDEQEDEFESDRRVGFQVEGEDDDFYKRPPKLHRRDTPHHLKN
KRVQHLTDKQASEILANALASQERNDTTPQHSLSGKVTSPIEEEEQLEVEQEQQQQQQQH
PFDSSLSPISAGKTAEASTDPDNLDGVTELRLEQYEIHIERTAAGLGLSIAGGKGSTPFK
GDDDGIFISRVTEAGPADLAGLKVGDKVIKVNGIVVVDADHYQAVQVLKACGAVLVLVVQ
REVTRLIGHPVFSEDGSVSQISVETRPLVADAPPAASISHERYIPAPIEIVPQQQHLQQQ
QQQPIQQVAPTHSYSGNVFATPTAAQTVQPAVSAAPNGLLLNGREAPLSYIQLHTTLIRD
QIGQGLGFSIAGGKGSPPFKDDCDGIFISRITEGGLAYRDGKIMVGDRVMAINGNDMTEA
HHDAAVACLTEPQRFVRLVLQREYRGPLEPPTSPRSPAVLNSLSPSGYLANRPANFSRSV
VEVEQPYKYNTLATTTPTPKPTVPASISNNNNTLPSSKTNGFATAAAATIDSSTGQPVPA
PRRTNSVPMGDGDIGAGSTTSGDSGEAQPSSLRPLTSDDFQAMIPAHFLSGGSQHQVHVA
RPNEVGVSAVTVNVNKPQPDLPMFPAAPTELGRVTETITKSTFTETVMTRITDNQLAEPL
ISEEVVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRIL
KVNEADVSKATHQDAVLELLKPGDEIKLTIQHDPLPPGFQEVLLSKAEGERLGMHIKGGL
NGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRN
AGNEIQLVVCKGYDKSNLIHSIGQAGGMSTGFNSSASCSGGSRQGSRASETGSELSQSQS
VSSLDHEEDERLRQDFDVFASQKPDAQQPTGPSVLAAAAAMVHGASSPTPPAATSNITPL
PTAAAVASADLTAPDTPATQTVALIHAEQQAHQQQQQTQLAPLGQEKSTQEKVLEIVRAA
DAFTTVPPKSPSEHHEQDKIQKTTTVVISKHTLDTNPTTPTTPAAPLSIAGAESANSAGA
PSPAVPASTPGSAPVLPAVAVQTQTQTTSTEKDEEEESQLQQRGTQTPDRLAPGARYSYQ
QMLESQEENRTSGKATQAKPKKAEPVYIIDDEDDEDDDDAGSQRLDDIDAIQEEEEEEDT
ESSPPLEVQSPPSYADTDSDTFDRRRGRYTSDSESDCRPYKPSRSGRSTPEYGGHRKSVS
FDLSGDERSRSDYERSRSRTPDGYTRAYDSEHDTRGSGRNRLPRKGILRATSPCATLEKS
EPIVPAVARIRDVESPQLQRVSRATSPDRPGELDRENPFRHPTSEDDEYTRIAKEVSKSP
RSPRSTREQFFFGSSRSSEDLLEQSQSLSSGRSTPSTVISKSTENLTGTRPKIPPPTAPK
PQLKKANLVRNVALETFQASDVGQGDFTVFEHDASTNTIHPVEAKVPVRVSSKTKPSRPR
ESPPPPPVNFATLPKLPSTPTLREAEESIYMEALPPTPSQLRPHEFVHENSPDNILVSPQ
EHREYLLRENELRNQLRAPYEPAPPVPIVGGGYSVTNPFLDSFDTDIDSLPLPPPPTPPA
QHQHTRHLHEPPQFPQFAPPLTANASTSPSCSSNAASAGGATNRLMDSPQQQLLVAGSPT
QIFPTAQILPVQYASLPQPQQPNTLTLKTVSPTSSQDPKQALFNLVLLPGDQVANKSSPA
MLYLQTVSESSAKPRRGPPPPPPVTVTSPTPSYAAMKFPTFSEIVVSPDANSNYQNMTTA
RVGVSNSSLAHSTSSFSIGSSSSSLLMTKNSSLGEGSVPSSYYETAEEIYSTIEEEAIYS
NTSFFDSRRSSDTSVSCRASKSPTPPPLPPKRPLKPTKLRTAPAPPPVAQKPHGLRGMAS
FKLRSQSQPQLDGAWQQPNLPRTPTTPTGKETTV
Download sequence
Identical sequences A0A0B4K6I1
NP_001247319.1.81976 FBpp0300854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]