SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300857 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300857
Domain Number 1 Region: 9-260
Classification Level Classification E-value
Superfamily L domain-like 1.13e-53
Family Internalin LRR domain 0.012
Further Details:      
 
Domain Number 2 Region: 191-392
Classification Level Classification E-value
Superfamily L domain-like 6.8e-40
Family Internalin LRR domain 0.039
Further Details:      
 
Domain Number 3 Region: 1164-1260
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-25
Family PDZ domain 0.004
Further Details:      
 
Domain Number 4 Region: 741-844
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-24
Family PDZ domain 0.00097
Further Details:      
 
Domain Number 5 Region: 1261-1359
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-22
Family PDZ domain 0.00033
Further Details:      
 
Domain Number 6 Region: 951-1054
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-21
Family PDZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300857   Gene: FBgn0263289   Transcript: FBtr0308633
Sequence length 2577
Comment pep:known chromosome:BDGP5:3R:22362072:22429773:1 gene:FBgn0263289 transcript:FBtr0308633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKCIPIFKGCNRQVEFVDKRHCSLPQVPEEILRYSRTLEELFLDANHIRDLPKNFFRLH
RLRKLGLSDNEIGRLPPDIQNFENLVELDVSRNDIPDIPDDIKHLQSLQVADFSSNPIPK
LPSGFSQLKNLTVLGLNDMSLTTLPADFGSLTQLESLELRENLLKHLPETISQLTKLKRL
DLGDNEIEDLPPYLGYLPGLHELWLDHNQLQRLPPELGLLTKLTYLDVSENRLEELPNEI
SGLVSLTDLDLAQNLLEALPDGIAKLSRLTILKLDQNRLQRLNDTLGNCENMQELILTEN
FLSELPASIGQMTKLNNLNVDRNALEYLPLEIGQCANLGVLSLRDNKLKKLPPELGNCTV
LHVLDVSGNQLLYLPYSLVNLQLKAVWLSENQSQPLLTFQPDTDAETGEQVLSCYLLPQQ
EYQPITPDYPPMTLYRSSEKFDSTEFFSYQQKARDLESDSEPFEEREPSRTVVKFSEEAT
QEKETPFVRQNTPHPKDLKAKAQKLKVERSRNEEHANLVTLPEENGTKLAETPTETRTIA
NNHQQQPHPVQQPIVGVNSKQPVVVGVVTPTTTTVAPTGVQGGSEGASSTANNVKAATAA
VVAELAATVGGSDEVQDDDEQEDEFESDRRVGFQVEGEDDDFYKRPPKLHRRDTPHHLKN
KRVQHLTDKQASEILANALASQERNDTTPQHSLSGKVTSPIEEEEQLEVEQEQQQQQQQH
PFDSSLSPISAGKTAEASTDPDNLDGVTELRLEQYEIHIERTAAGLGLSIAGGKGSTPFK
GDDDGIFISRVTEAGPADLAGLKVGDKVIKVNGIVVVDADHYQAVQVLKACGAVLVLVVQ
REVTRLIGHPVFSEDGSVSQISVETRPLVADAPPAASISHERYIPAPIEIVPQQQHLQQQ
QQQPIQQVAPTHSYSGNVFATPTAAQTVQPAVSAAPNGLLLNGREAPLSYIQLHTTLIRD
QIGQGLGFSIAGGKGSPPFKDDCDGIFISRITEGGLAYRDGKIMVGDRVMAINGNDMTEA
HHDAAVACLTEPQRFVRLVLQREYRGPLEPPTSPRSPAVLNSLSPSGYLANRPANFSRSV
VEVEQPYKYNTLATTTPTPKPTVPASISNNNNTLPSSKTNGFATAAAATIDSSTGQPVPA
PRRTNSVPMGDGDIGAGSTTSGDSGEAQEVVLPKNQGSLGFSIIGGTDHSCVPFGTREPG
IFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKPGDEIKLTIQHDPL
PPGFQEVLLSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVG
MRLLEVNGHSLLGASHQDAVNVLRNAGNEIQLVVCKGYDKSNLIHSIGQAGGMSTGFNSS
ASCSGGSRQGSRASETGSELSQSQSVSSLDHEEDERLRQDFDVFASQKPDAQQPTGPSVL
AAAAAMVHGASSPTPPAATSNITPLPTAAAVASADLTAPDTPATQTVALIHAEQQAHQQQ
QQTQLAPLGQEKSTQEKVLEIVRAADAFTTVPPKSPSEHHEQDKIQKTTTVVISKHTLDT
NPTTPTTPAAPLSIAGAESANSAGAPSPAVPASTPGSAPVLPAVAVQTQTQTTSTEKDEE
EESQLQSTPASRDGAEEQQEEVRAKPTPTKVPKSVSDKKRFFESAMEDQHKPTQKTDKVF
SFLSKDEVEKLRQEEERKIATLRRDKNSRLLDAANDNIDKDAAQQRTKSNSNSSSGDDND
DSDQEEGIARGDSVDNAALGHFDDAEDMRTAQSLASTMPHAPSKIPKQKLKAKQIESSLP
TPTALDPPKPSLLPKPKVKVVIPPALQQRLKQQQVQQQQQQHQQSQPEEPSIPEEEYHQQ
PEPDSPSAAGGSRIPVRTLKAERRALTLAARQSGLSVEEYLKRLETQDDKESPASPTTPT
GKSRSMINAEKRASWRAARLRSLEQGAVEAQDVIKNMRKMTDDLITHESRASEAQPKIVF
PKIAIKSSDGPVIVREREKILDEKIVRRTEEVACPITGRPQLRTVEYIEKIIETEVETCK
ERIISLELQVPETEDEGKLDDTQPPLELEADDFQDDEDDDDDDDDEDDFEDEDEEEDTAS
IVTVQANNEKLFLRHDSDTYGPSSIESVASGKVRIKPTPLSLHQTLAKETTIVEVLNPVI
GGDGSARTIHVSGGLPFDEDAFEQGAVAVLRSETFVLPGAAGGGRSELSLNAKMKTVLEE
LLENERVKLNLQKSLEGEEGEDDDDEDENGSAYGDARDEEESAYGDAIDDVVDFGSATVT
SRAANDKDDVKNGNQQLLEELIKDSNRNTIIAKLAGQLSDDDEEDDDEEESSDSSDDDSD
DSDEEDNAQQQLNVTYVQGAQVIENLNTLATGGKLQKSQTYTAIKQAEEPKEEDTKLEED
PSAEKPCGADTLAKLQAEQRALAEISKQLRKSVEDLLSADGETVVETQRTYTLPAPSDSS
AVVTVTEVVKKQKKKKSETGEELFNRLLNAAESERQVFDRQQGETITTTTTTTEAVSSED
NEPSTSVVTTTRTVSNIVTSGIPRPETSKQNNRSSSSSNSNSSNNNRNKNKRKGKKK
Download sequence
Identical sequences A0A0B4K7W1
FBpp0300857 NP_001247321.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]