SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300870 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300870
Domain Number 1 Region: 154-493
Classification Level Classification E-value
Superfamily RNI-like 4.55e-41
Family Cyclin A/CDK2-associated p19, Skp2 0.054
Further Details:      
 
Domain Number 2 Region: 673-815
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 7.59e-37
Family Toll/Interleukin receptor TIR domain 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300870   Gene: FBgn0036978   Transcript: FBtr0308647
Sequence length 826
Comment pep:known chromosome:BDGP5:3L:20354943:20359023:-1 gene:FBgn0036978 transcript:FBtr0308647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPKYIWDVIVLVCLFLGNVREAYTEFSIQDGLIIEPDSATTSSEEAEEVSKERTDLKSL
MLKYESDDGNSCLLDLIKDEVIWWQFPNGTLRDSTKKYAHKLYLDLSHGNLKDDSDLFRE
AKLSRKVTIWRTEVFSAAFNTLTAAPFRTLYSMRESLKLLSLRGNNFAELIPDAEAQSIA
WATFPKMPRLVELDISNCSIEYVSKEAFRNVSNLRRLFMSDNKIMTISHDTFYYVQGVQY
LDLSFTNFLTYSYQLQLPTLEMALSLIYGLKIQQNVFKYLPELIYLDLSHSKMTRNSAVA
FAHLGDKLKFLSLCYTAIPMVSSTIFKNTVLEGLDLSGNPYLSYNIIDDAFDGIANTLKY
LYFERSNIKDLEWSKSLKNLQVLGLAGNNINALTPAMFQSLESLEILDLSSNHVGNWYRS
AFHNNSALRVLNLRSNTINMLSNEMLKDFERLDYLSLGDNDFICDCHLRAVVEVAAANNK
DADCSYRLLNYSQNAVGEEVISLAESLIIDRKLWQSRYIPWLQRSYSNIREFNRANHIIK
LRFSSEDYMVAKCSAAQPYHLGDLDGDLTLKFQLLDYEASQYYCFNNTDQLQVDELNCQI
RSMSDLAEELHHVTNTVIAVMGSLVGACILGFIIYLKRWHIHYYYSSLKSAALLSSASKE
SVNKFTNISQRDPSAVYDIFISYCQNDRTWVLNELLPNVEETGDVSICLHERDFQIGVTI
LDNIISCMDRSYSLMLIISSKFLLSHWCQFEMYLAQHRIFEVSKEHLILVFLEDIPRRKR
PKTLQYLMDVKTYIKWPTAKEDRKLFWKRLKRSLEVIGINSREISV
Download sequence
Identical sequences M9NDW9
FBpp0300870 NP_001246845.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]