SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0300910 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0300910
Domain Number 1 Region: 109-190
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000628
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0300910
Domain Number - Region: 28-115
Classification Level Classification E-value
Superfamily EF-hand 0.000395
Family Calmodulin-like 0.045
Further Details:      
 
Domain Number - Region: 346-452
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00602
Family DNA repair protein MutS, domain III 0.048
Further Details:      
 
Domain Number - Region: 106-350
Classification Level Classification E-value
Superfamily TPR-like 0.0311
Family HAT/Suf repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0300910   Gene: FBgn0045073   Transcript: FBtr0308704
Sequence length 477
Comment pep:known chromosome:BDGP5:X:15829061:15834455:-1 gene:FBgn0045073 transcript:FBtr0308704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKNTIWNYSLIFFCCVLKSISSMGSGSADGACAADDFDCYSGSVQDRFGMEAIASLHRQ
LDDDDNGNIDLSESDDFLREELKYDSGYEKRQKAFHFNDDMHISVKELWEAWLRSEVHNW
TIEQTTDWLAQSVQLPQYVDLFKLHKVTGAALPRLAVNNLQYVGNVLGIKDPIHKQKISL
KAMDVVLFGPPRETGTRWKDYILVTLLLSAIIGCWYAYQQNKNAKRHLRRMAQDMEGLQR
AEQSLQEMQKELERARMEQENVATEKLDLERRLKEAPTLSSSNSDLEVQQLKKEIEMLRN
ELSRAEFELVDNCWSPPPQLQSWLQYTYELESKNHQKKRTSAEKQLQSAREACEKLRKKR
SSLVGAFVSTHGKSIDDVDRSIVEARNALGDVTNELQERLHRWKQIETCLGLNIVNNNGL
PYLENVLYGRNGGLQSSMGMSSTKGSRARITNSTEDLDDESIQGKLNFENFSLLATE
Download sequence
Identical sequences Q7KUZ0
FBpp0300910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]