SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0301053 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0301053
Domain Number 1 Region: 181-254
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.77e-17
Family Cold shock DNA-binding domain-like 0.0000926
Further Details:      
 
Domain Number 2 Region: 752-829
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000195
Family Cold shock DNA-binding domain-like 0.0047
Further Details:      
 
Domain Number 3 Region: 498-583
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000309
Family Cold shock DNA-binding domain-like 0.002
Further Details:      
 
Domain Number 4 Region: 334-411
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000103
Family Cold shock DNA-binding domain-like 0.0025
Further Details:      
 
Domain Number 5 Region: 912-983
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000176
Family Cold shock DNA-binding domain-like 0.0029
Further Details:      
 
Weak hits

Sequence:  FBpp0301053
Domain Number - Region: 286-338
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.075
Family Cold shock DNA-binding domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0301053   Gene: FBgn0263352   Transcript: FBtr0308954
Sequence length 1032
Comment pep:known chromosome:BDGP5:3L:8425658:8435415:-1 gene:FBgn0263352 transcript:FBtr0308954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTQSKVYRTGEEIYDNLPCDSYFNMNAIRNLGIPTTFPTIGTFTLDSTTLGLQPQGQGP
SPQQQQHQQQQQQQQQQHQQNMHHHQHQQQHMQQQQQQQQHQQQHQQQQHQQQQQHQQQQ
QQQQQHPTIGMFDANEVNDVIQNPPQIGVFQSNSVLTNGAGSGSSIFGSQSSNSSAAAAD
PSQTTRETGIIEKLLHSYGFIQCCERQARLFFHFSQFSGNIDHLKIGDPVEFEMTYDRRT
GKPIASQVSKIAPEVVLSEERVTGTVTTELRTDSANNVLNSSETTGRISYENRGECFFLP
YTKDDVEGNVNLRAGDKVSFQIATNQRGNLGACHIRLENPAQPVKYRGVVCSMKESFGFI
ERADVVKEIFFHFSEAEGNVELRPGDDVEFTIQTRSGREFACNITRLAPGSVIFEDVDST
VYKGQVLKSLDRNNPVRQNNDPLPGRIRYRALDYSEVEVPFGDKDQKGDFTLRHGDWVQF
LLATDRRDQLQRATSIALLDETFKVSGEKREQGTIASLKEGFGFLRCVERQARLFFHFTE
VLDTSREIDINDEVEFTVIQEPGLAYNNSRLQAIRIKHLPPNSVQFETLVASNIEGCVTR
EAPKSPIKSQDRVEGGVITYEHADVKKTIMYFLKDCEKPPRIGERVRFDIYMVKRNKECI
AVNVQQVSLHQQQQQQQQQLHLNQSNAGANINQNDQLGGLSNGISSSSSNASLQNGYVMH
GSPGGSTSSVGSNNPVHLDEFKMENNNHAGSDAGQVYRGFIAVMKENFGFIETLSHDEEV
FFHFSNYMGNPNWLELGQEVEYTLARNGNTSVSGNCLPAENVRMLPKNSIPQPAVLETTH
NGVVARPLRCINPDQQEYAGLIEILDELRTTVISQHEFGITSLVNKRDLLQKGDLVSFRI
DESGRAACVNAVRQKKRATVDSIKGQFGFLNFEVEDGKKLFFHMSEVQGNTVALHPGDTV
EFSVVTNQRNGKSSACNVLKINDRPDRLISRLKLNGDDTVPRLILIRAPKGPQGKGFSVL
ARHPRIPGNLVE
Download sequence
Identical sequences M9ND61
FBpp0301053 NP_001246669.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]