SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0301162 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0301162
Domain Number 1 Region: 46-280
Classification Level Classification E-value
Superfamily L domain-like 1.22e-36
Family Ngr ectodomain-like 0.0062
Further Details:      
 
Domain Number 2 Region: 279-380
Classification Level Classification E-value
Superfamily Immunoglobulin 5.88e-16
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0301162   Gene: FBgn0031016   Transcript: FBtr0309223
Sequence length 931
Comment pep:known chromosome:BDGP5:X:19247218:19364074:1 gene:FBgn0031016 transcript:FBtr0309223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGNRTERSGRRLGMILLLLGVLVVLMALPPPTAGTTDWMQSCGTCHCQWNSGKKSADCK
NKALTKIPQDMSNEMQVLDFAHNQIPELRREEFLLAGLPNVHKIFLRNCTIQEVHREAFK
GLHILIELDLSGNRIRELHPGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRN
NRLRQVQLHVFAGTMALSAISLEQNRLSHLHKETFKDLQKLMHLSLQGNAWNCSCELQDF
RDFAISKRLYTPPTDCQEPPQLRGKLWSEVPSENFACRPRILGSVRSFIEANHDNISLPC
RIVGSPRPNVTWVYNKRPLQQYDPRVRVLTSVEQMPEQPSQVLTSELRIVGVRASDKGAY
TCVADNRGGRAEAEFQLLVSGDYAGAVSASDGMGMGAIGAPTIDPQTNMFLIICLIITTL
LLLLLVAVLTLFWYCRRIKTYQKDTTMMSGDGLISSKMDKTHNGSMLEGSVIMEMQKSLL
NEVNPVEKPPRRTDIESVDGGDDVLEIKKTLLDDTVYVANHSRDEEAVSVAMSDTTTTPR
SRHTYVDDAYANSLPPDLLAFPARVPPTSPSMQSSQSNIPDQVIYGIRSPPSLTSPVYTH
MTPHGIYGTKTMTAPHNGFMTLQHPKSRNLALIATTNSSRQHQHHHQLQQQQQHHHHHQQ
QQQQQQQQQHPLATTSPFLPAPVVYSPATGVVMKQGYMTIPRKPRAPSWAPSTSGAAGHG
SIQLSEFQSPTSPNPSETGTATTAELQAEPVYDNLGLRTTAGGNSTLNLTKIAGSQGGAG
QQYSMRDRPLPATPSLTSVSSATNASKIYEPIHELIQQQQQLQQQQQQQQQRLGSMDTEP
LYGVRQQGITILPGSSISGAGLGHAAYLSPGSGAAVSPSHASSSGDSPKAAKIPPRPPPK
PKKKMSVTTTRSGQGSTSQLFDDEGEDGTEV
Download sequence
Identical sequences Q9VWI6
7227.FBpp0074476 FBpp0074476 FBpp0074477 FBpp0074476 NP_001245746.1.81976 NP_573382.1.81976 NP_728242.1.81976 NP_728243.1.81976 FBpp0074476 FBpp0074477 FBpp0301162 FBpp0301163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]