SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0301204 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0301204
Domain Number 1 Region: 14-298
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.31e-44
Family FCH domain 0.0092
Further Details:      
 
Domain Number 2 Region: 658-726
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-21
Family SH3-domain 0.00064
Further Details:      
 
Domain Number 3 Region: 538-604
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-18
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0301204   Gene: FBgn0263456   Transcript: FBtr0309277
Sequence length 821
Comment pep:known chromosome:BDGP5:3L:9130960:9135070:1 gene:FBgn0263456 transcript:FBtr0309277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPPRKGNYVKFLKNLHTEQVAKLQLKNQHECDLLEDIRQFTIKRSAVEKSYSESLLKI
SSQYLNKKIPNIPDIKMEGMEERWNMWSVWRTVLEENEKLARARLAAIEVFQQQIADEAK
VLRDYKLAIAKRSLAGIVNVQKELHLSVGDVDKTKKSYFDEEHCAHDVRDKARDIEEKLK
KKKGSFFQSITSLQKNSARVTSRKELLEEKSSGARNDYVLSLAAANAHQNRYFTVDLQTT
MTTMENYVFERVAEYLMLMGRTELLTCSATQNSFGKIRDQAQQLTREYNLQCCYLFYPVL
KQHIQYDFEACDNDPVRKVTAEHESAAETLTKEAKNLAGRVVKENASIRENAKKLALCQS
LRDSGQRTDPNDPNGPDLDTKIEEFRDQIRRSETEKTKAEACLQCLRDGGINVDEWVQEA
ENMGVQELTRSASSISMRTDASGQGENPSSDSFYDSDKEETQAAAQTKPKQEQQLSRDRT
FSDSEDEPEVRPSAAAASSAAAASSSMMASSAGGWDDPTEVNWGAGEEEDDKDEPIVPEP
KEAIFKCTALYSYTAQNPDELTIVENEQLEVVGEGDGDGWLRARNYRGEEGYVPHNYLDI
DQETAGSAFNGTSGNQLRSQISFSSVDYTVDNEDQTVDSMQSPDQVSVIMAPQKRVKSDV
EWCIALYDYDATAEDELTFEEGDKIKIITKTAHGVDDGWWEGELDGKFGNFPSLVVEECD
EMGEPLSEGGDESPPPTAAPTFALPPAPALPPEYAHELELELTEDMFGSQDTADEDSGYI
PNGAAAPSIPPPGKCHILALSTGLLFPLSISLFKLYPYRFL
Download sequence
Identical sequences M9NFQ1
FBpp0301204 NP_001246690.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]