SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0301207 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0301207
Domain Number 1 Region: 14-298
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.57e-44
Family FCH domain 0.0092
Further Details:      
 
Domain Number 2 Region: 658-726
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-21
Family SH3-domain 0.00064
Further Details:      
 
Domain Number 3 Region: 538-604
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-18
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0301207   Gene: FBgn0263456   Transcript: FBtr0309280
Sequence length 885
Comment pep:known chromosome:BDGP5:3L:9130960:9138793:1 gene:FBgn0263456 transcript:FBtr0309280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPPRKGNYVKFLKNLHTEQVAKLQLKNQHECDLLEDIRQFTIKRSAVEKSYSESLLKI
SSQYLNKKIPNIPDIKMEGMEERWNMWSVWRTVLEENEKLARARLAAIEVFQQQIADEAK
VLRDYKLAIAKRSLAGIVNVQKELHLSVGDVDKTKKSYFDEEHCAHDVRDKARDIEEKLK
KKKGSFFQSITSLQKNSARVTSRKELLEEKSSGARNDYVLSLAAANAHQNRYFTVDLQTT
MTTMENYVFERVAEYLMLMGRTELLTCSATQNSFGKIRDQAQQLTREYNLQCCYLFYPVL
KQHIQYDFEACDNDPVRKVTAEHESAAETLTKEAKNLAGRVVKENASIRENAKKLALCQS
LRDSGQRTDPNDPNGPDLDTKIEEFRDQIRRSETEKTKAEACLQCLRDGGINVDEWVQEA
ENMGVQELTRSASSISMRTDASGQGENPSSDSFYDSDKEETQAAAQTKPKQEQQLSRDRT
FSDSEDEPEVRPSAAAASSAAAASSSMMASSAGGWDDPTEVNWGAGEEEDDKDEPIVPEP
KEAIFKCTALYSYTAQNPDELTIVENEQLEVVGEGDGDGWLRARNYRGEEGYVPHNYLDI
DQETAGSAFNGTSGNQLRSQISFSSVDYTVDNEDQTVDSMQSPDQVSVIMAPQKRVKSDV
EWCIALYDYDATAEDELTFEEGDKIKIITKTAHGVDDGWWEGELDGKFGNFPSLVVEECD
EMGEPLSEGGDESPPPTAAPTFALPPAPALPPEYAHELELELTEDMFGSQDTADEDSGYI
PNGAAAPSIPPPGQNQSQTTAKKGNLMNMLFYLNYLIPETFPDSVILSVGKSISTPLFES
MSNPPLNYCSTFKMRFSSWYIEKNIQYIFSIRFLSTCLQLFPKDI
Download sequence
Identical sequences M9NF56
NP_001246692.1.81976 FBpp0301207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]