SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0301283 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0301283
Domain Number 1 Region: 37-94
Classification Level Classification E-value
Superfamily RING/U-box 3.18e-16
Family Variant RING domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0301283   Gene: FBgn0035983   Transcript: FBtr0309506
Sequence length 617
Comment pep:known chromosome:BDGP5:3L:9379927:9392327:-1 gene:FBgn0035983 transcript:FBtr0309506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCDNAKTSSDIEHVDWNSGQHYANVRFGSGSSQASQNSGDICRICHCESDPQNPLLTPC
YCSGSLKYVHQACLQQWLTASETNSCELCKFPFIMHTKIKPFNEWRSLDISGIERRRLCY
SVLFHCAAALCVIWSLCVLIERAADDVQRGLIDWPFWTKLAVVTVGLTGGIVFMYIQCKA
YLHLCHRWKARNRILLIQNAPEKIHPVAPPSPVAAHHQHFSEPLAHAGSTSGAVEINASG
AAGGYCAHEANCASMDNGGGGAEMGLHQQMQRLLNASPHHMLQMAAELEVPHSSSSACTQ
TEDGHGHQRHQQMQQSGQQLGQVAVAANIECSQSQHNYDRDWALDDVVSQISSFRPCPQG
SGSMTPFHDSIHNVLEHSEGSSRGSATDLCAGSRQDLSASGISTDTGREHALQLSSFSGS
GEHKAPSISSGVSHAVANGLGGFVYKPHQTKRYSNSSIFLENRDVLSDQTSVGPDTAVHP
YDYSTPPKIDYRHSGIMGVDLPIGCCTTDCLGGQPTKEELRRYSDPKLKAGEADTVLDID
LPTSPLSPPAAYASSQQKQRNSHQLVISSSFDRGVNGVSSSKSSRGYGPSDAQVDRSRLS
FKSLPNLSSSCESLLQK
Download sequence
Identical sequences Q9VSX7
7227.FBpp0076222 FBpp0076222 FBpp0076222 NP_001246695.1.81976 NP_648305.1.81976 FBpp0076222 FBpp0301283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]