SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0301578 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0301578
Domain Number 1 Region: 91-323
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.73e-39
Family PhyH-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0301578   Gene: FBgn0033233   Transcript: FBtr0309844
Sequence length 489
Comment pep:known chromosome:BDGP5:2R:3810280:3812488:-1 gene:FBgn0033233 transcript:FBtr0309844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTRSSFADEEQNKVPRIMTFRPSYEEFQNFSAYIEYIESRGAHLAGLAKIQPPAEWVPR
KSGYDIDNINMTIPAPICQVVTGAHGVYQQINIQQRRQMTLRQFMEKANSELHQTPRHFD
YDDLERKYWKNITYISPLYAADVKGSLSDEDLDVWNIGRLDTILNLVNTDYNIIIDGVNT
AYLYFGMWKSSFAWHTEDMDLYSINYLHFGAPKTWYAIPPAYGRRLEKLANETFSENYQE
CNAYLRHKMTMISPKVLRQHNIPYNKITQEAGEIMITFPFGYHAGFNHGFNGAESTNFAS
KRWIEYGKRASICRCRSDMVKISMETFVRRFQPERYDNWLKGQDMGCHPEEPGKICAAAP
PTLNDLRAAKSEEESPQKRGCSLAGNGCERNAESAEDVDDKASVSSYSSCRQLQPVVKLR
KLPTIASVPEPSSAPKRYDFNTEAVVRVKRLWNELPCPDRGANLLTNGVVKNTKRMRFQT
KVLTLDDED
Download sequence
Identical sequences A0A0B4K7U3
NP_001246194.1.81976 FBpp0301578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]