SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0301585 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0301585
Domain Number 1 Region: 34-248
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-68
Family SPRY domain 0.00000000104
Further Details:      
 
Domain Number 2 Region: 237-277
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000837
Family SOCS box-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0301585   Gene: FBgn0026238   Transcript: FBtr0309851
Sequence length 279
Comment pep:known chromosome:BDGP5:2R:1004718:1009755:-1 gene:FBgn0026238 transcript:FBtr0309851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKISGGVKTVSRNDSQSTFKPIIPRELQADFVKPARIDILLDMPPASRDLQLKHSWNS
EDRSLNIFVKEDDKLTFHRHPVAQSTDCIRGKVGLTKGLHIWEIYWPTRQRGTHAVVGVC
TADAPLHSVGYQSLVGSTEQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDKFL
VALDMDEGTLSFIVDQQYLGIAFRGLRGKKLYPIVSAVWGHCEITMRYIGGLDPEPLPLM
DLCRRTIRQKIGRTNLEEHIQQLQLPLSMKTYLLYKNRR
Download sequence
Identical sequences A0A0B4K6X3 A1Z6E0
FBpp0301580 FBpp0301581 FBpp0301582 FBpp0301583 FBpp0301584 FBpp0301585 FBpp0301586 NP_001246140.1.81976 NP_610158.3.81976 NP_724398.2.81976 NP_724399.2.81976 NP_724400.2.81976 NP_724401.2.81976 NP_724402.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]