SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0301685 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0301685
Domain Number 1 Region: 22-317
Classification Level Classification E-value
Superfamily TPR-like 2.39e-74
Family HAT/Suf repeat 0.00000000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0301685   Gene: FBgn0003559   Transcript: FBtr0309956
Sequence length 350
Comment pep:known chromosome:BDGP5:XHet:76177:77847:1 gene:FBgn0003559 transcript:FBtr0309956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSARDLIKVDIEWGMERLVRAQQVVELRPYDIESWSVMIREAQTRPIHEVRSLYESLVN
VFPTTARYWKLYIEMEMRSRYYERVEKLFQRCLVKILNIDLWKLYLTYVKETKSGLSTHK
EKMAQAYDFALEKIGMDLHSFSIWQDYIYFLRGVEAVGNYAENQKITAVRRVYQKAVVTP
IVGIEQLWKDYIAFEQNINPIISEKMSLERSKDYMNARRVAKELEYHTKGLNRNLPAVPP
TLTKEEVKQVELWKRFITYEKSNPLRTEDTALVTRRVMFATEQCLLVLTHHPAVWHQASQ
FLDTSARVLTEKGVRTSVENISPILCVPVVNQIEWVMAFAWWWAKVKTKN
Download sequence
Identical sequences FBpp0301685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]