SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0301715 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0301715
Domain Number 1 Region: 1151-1483
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.64e-65
Family Ankyrin repeat 0.0000358
Further Details:      
 
Domain Number 2 Region: 1505-1613
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000607
Family Tetratricopeptide repeat (TPR) 0.0045
Further Details:      
 
Domain Number 3 Region: 627-679
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000816
Family RecA protein-like (ATPase-domain) 0.091
Further Details:      
 
Weak hits

Sequence:  FBpp0301715
Domain Number - Region: 91-139
Classification Level Classification E-value
Superfamily RING/U-box 0.000141
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number - Region: 652-710,753-805
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000282
Family RecA protein-like (ATPase-domain) 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0301715   Gene: FBgn0041096   Transcript: FBtr0310009
Sequence length 1669
Comment pep:known chromosome:BDGP5:3L:12001325:12049574:-1 gene:FBgn0041096 transcript:FBtr0310009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPLTNRSSSGNRTNNNPSNNNNNQTTSFIIGGTTNINNNNNQLGGTNSAKDKGNFENNW
SCNKTTGRRSGSGNSCSFLDLQSIRRLLEHDASGSVCPSCRISFDKGKRRKLIDTCGHER
CYSCMFRNDQCPMCMNSSLKDVDGANAQGYDTGIGGSTSTIVSPLGSPQPQLRSHAQRNA
ALARYMQHRQESQSPDYHHRYASNGKLPRAAALSTNGNGFTTGTTQTVTVDVHHQLGGGG
GGAAAAAKQLMANGISGHSRSSSMSHNIHAAAYSELSAAPPAFATPPTRRRFFNHKNLRS
ALTGGSGGGSGVGGGVGGAGGVGGGHRRTASNGGCPIDTASILSGDHTHQHHHRDNQPEG
KESNALNTSTCSDSAVTRRRRKNVSNHNLKTSARHGASSENRLNRLSLAGTSVYAGHLSS
LVFGKIKSLWSVNSSNSSEAGLNQLAGSDAIDHHSSFLNEKLQKDQLHARLGLLLNDPGS
NGNSSSSGSGCEPISAHSTTSTTSSSGVGAASTTTSGSSQNVSPEQTLASGAGMLSGSQL
SVATSHGVKEDALSLCGKFKAGCSMLHVYEALPSKSRKGNVRRSTRGQQGSSSSASAASA
VGSRVTASSLAAVQLALKPLFFEVPLQEPDPPYVGRQWLVQQLSNILLGTETRVVLINGQ
PGTGKTAFCLQLVEYSCFGRRQMQDDPDGIYSQLQLGAHCERMRGLASHMVGYHFCQADA
NLTCQVPDFVHSLAAQLCQAPQLTAYRDYLLSEPHLQDILSVRECIADAERVMKLAILEP
LAHLHRAGKIPAKVAVIVVDALCEAEYHRPDHGHTIASFLAQLTPHFPAWLKLVATVRTQ
MLELVKAPSYTQLTLDSWASSQALQQDMLDYIGARLADSPEIRMNIGGGGGQNSQSGSQP
QTKFVSHLQSLSRGSMLYAKLILDLIARGQLVIKSSSYKVLPVSLAQIFLLHFNLRFPTA
RSFEQAAPILNICLAALYPLTLDEIYYSMEALSHGREALSWPDFMQRFKLLDGFLIKRLD
NTYMFFHSSLREWLMRRDEGESNKFLCDARLGHAGIAFRLSRLQAPLSPQLTLELGHHML
KAHLYGGTSLTLLSPRDLQSYWLAGAADNISSSLGALRNVYSPNLKVSRLVLLAGASPNH
RTDYMGGAPILCIAAHEGILPMVSLLLEFGADVGLTNSQGCTPLILAAMRGHCDVVRPLV
AAGSSLGQLDITQRCALVHAARMGHLSVVKYLLACDWSPRPHSQDVTRSVALQQALIGAA
AQAHCKILEDLLDLNETEFDLDVNGMEPSSGELALTAAARHGCIDVVGILLSRGAQIDAR
NRQGYSALWLAVKEGHWSVVEHLLQRGALLDEPLGQTRKTPLMIAAEEGHLELVDLLLAR
GAQREAQDHEGFTALSWACLRGHLAAAKTLIEHGCNRHHEDHNGRTALDLAAYQGAASLV
IYILEQGGNLEHIDVHGMRPLDRAIACRNIQAVQVFLRKGAKLGPTTWSMAMGKPEILVI
LLNKLLEDGNVLYRKNRFQEAAHRYQYALRKISGLEQLLERNAIFAQLRTNLLLNLSRCK
RKLNELDASIDLATQAIAQKPHSYEGYYARAKARMELGALNEALVDANEAMQQAAQSGVL
CEVVEVLKRIQTELLTRISISSEDQTGRMSNIGGGASVAYESHHEITDL
Download sequence
Identical sequences M9PFC6
NP_001261736.1.81976 FBpp0301715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]