SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0301720 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0301720
Domain Number 1 Region: 80-377
Classification Level Classification E-value
Superfamily L domain-like 1.36e-45
Family Ngr ectodomain-like 0.0072
Further Details:      
 
Weak hits

Sequence:  FBpp0301720
Domain Number - Region: 605-665
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0525
Family Fibronectin type III 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0301720   Gene: FBgn0261509   Transcript: FBtr0310017
Sequence length 981
Comment pep:known chromosome:BDGP5:2L:1555130:1608404:1 gene:FBgn0261509 transcript:FBtr0310017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGRTTTALPAATTPLLLLLPLILGRLHVAHAQCPWQRDVPDLQTSCICAYNLGRELSV
QCDQVDFSQLLAAMNTHARLKPVDLLYVNNSTISELPDAVFSNLSLHNLQLSSCGIQRIA
TGAFKGQESVLRNLNLQDNLLADVPVEALKVLGKLNLLDLSKNQLSHIPDDAFVGLTKLS
TLKLNDNNVTLASNAFRGLEQSLKNLNLKGTKQRKVPESIRGLKSLAFLDLSQNGIKELP
GAGGIRVFDGLDALTALNLERNLIQSIGETAFAGVRKTLSSLSLLNNLLAEFPIGAVHSL
KELRVLDIGFNLLTSLPEAAFRGNPGITLLALDGNPLSSVPEGAFAHLNATLRGLSLGGR
FLHCDCKLRWVAEWIRNGDLQVTSRERNPQFCGTPPRFRDRGFYSIQPEELSCPDIADAA
LRGPVGLADNLKPTLPSSPDSVEYETGTGTGTVGTGTAASAPVTSSVSSSTSTTTPTTTT
TTTTAEPTTRRSTTRPPTKSTTTISATTASPASNPPVNGTGTVQATSITTSSSSSSSSST
STGHGNGKQAPGWRQGVTNGNGNSGVGGAGGLHKPQRPPLVLGYPPQRGTRIDDANEVQV
KHAFRQDSSVIIQWDSDTANILGFRVVYRLFGEKAFKQGPPLESSEREFKIKNVPAQECI
IVCVISLEELHVTPETVPYQQCREVRTVASQASNMDKITIAASAAICGTIIVAVIVFIAA
SRRSRKLQSSQQKSPLPIGGLPVNCCGPTGSPGPLGSIATLSAFNNHKEWDQVSAYSGRS
IPRPRIYPVEQPDDMRSHFSGMPGKVGKSRSLADGQSQHSFSNNSHRGYLGSAFPSNLVN
SRPELRQSRQSLAAASERMSRASYAGSIHGGNGGGGGLGGNGGGGGNGLPVSSLMAMSGM
VGGGGPASIASSARRSRPRSRSREQLNTTHIHNHRPGSRYSQAGSTHTLNNYCDTSDNWT
DHDMDIYMARNPTTRNGLVPL
Download sequence
Identical sequences M9PC50
FBpp0301720 FBpp0301722 NP_001259873.1.81976 NP_001259874.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]