SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0301752 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0301752
Domain Number - Region: 149-190
Classification Level Classification E-value
Superfamily RING/U-box 0.0015
Family RING finger domain, C3HC4 0.039
Further Details:      
 
Domain Number - Region: 23-77
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00295
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0301752   Gene: FBgn0036730   Transcript: FBtr0310051
Sequence length 233
Comment pep:known chromosome:BDGP5:3L:17472408:17473241:1 gene:FBgn0036730 transcript:FBtr0310051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFNYLADSALSTLVENKKFFKEMSDFVSDFSDGGKIKKLLEQSVEQSVEHAVNVVHMKI
KHQSLNKAMNQVKNSSATIEEFEEVWKERSKAVEQKRINVKNLHEFKNFVKAVESAAGQA
GAEVNDQANGTAYDEDLIMEDSGSEVFSFYDPWSKALIKNPMRNKMCGHIYDRDSVMPII
MDRIGIRCPVLGCANLCYIQPDHLVQDANVQQKIQQSMSNAIVDVTASEEDEE
Download sequence
Identical sequences Q9VVH7
7227.FBpp0074985 FBpp0074985 NP_001261988.1.81976 NP_648987.1.81976 FBpp0074985 FBpp0301752 FBpp0074985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]