SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0301753 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0301753
Domain Number - Region: 90-134
Classification Level Classification E-value
Superfamily RING/U-box 0.000424
Family RING finger domain, C3HC4 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0301753   Gene: FBgn0030657   Transcript: FBtr0310052
Sequence length 177
Comment pep:known chromosome:BDGP5:X:15471019:15472017:-1 gene:FBgn0030657 transcript:FBtr0310052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSKHQLLSKAMKHAKNSSNTIEKFEEVWKERSEAVEQKRIDVKNSAEFKNFMKAAAPQA
GAETNGQANSAAHDEDLIMEATGGEVFSLYDPWSKALIKNPVRNKKCGHIYDRDSVMLII
TDNIGIRCPVLGCPNRSYIHPAHLVKDSNLQQKLQERMSDAIEKETSSEEDDEQADH
Download sequence
Identical sequences Q8IR31
FBpp0301753 NP_727868.1.81976 FBpp0088642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]