SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0301830 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0301830
Domain Number 1 Region: 83-192,232-289
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 7.98e-27
Family NAD kinase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0301830   Gene: FBgn0033373   Transcript: FBtr0310145
Sequence length 409
Comment pep:known chromosome:BDGP5:2R:4977279:4980310:-1 gene:FBgn0033373 transcript:FBtr0310145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQNGRKIIPEGLKYAKYTPTNFKLKRALVVTKLSRYEFEQLRHPELSPDQLQQKLRDRG
TDVEMVLHLHKVHKDFERRVVQSFQDVGCEVKLSSRSSLSKDVMSWADVIVPVGGDGTFL
LSAGRASPLFALSQQKTPIVGFNSDPLHSEGRLMLPKHYSDNPADAVSRIKSGDFKWMHR
SRVRTTMLGSNGNIPEPTDLFRHTEVKMEQVSTAPEMLDQDMAYKYKAKMKRVLPYLALN
EVFIGEHLSARVSHLQLVLDHQDVVNKTKCSGLCVSTGTGSTSWHTSINRITSRDVDDLL
RSLPDGDSKNVMMLRQNAEEIAQRYNQGLLFAPDDPRLCYSIREQICVGVWPSPKTFKER
DFVQTVFVKSHCIDANLVIDGSISFPFNDGAKALLEVHPEDALLTIALD
Download sequence
Identical sequences A0A0B4KEH3
FBpp0301830 NP_001260817.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]