SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0301887 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0301887
Domain Number 1 Region: 5-66
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.33e-20
Family SAM (sterile alpha motif) domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0301887   Gene: FBgn0051163   Transcript: FBtr0310203
Sequence length 128
Comment pep:known chromosome:BDGP5:3R:17999969:18000476:1 gene:FBgn0051163 transcript:FBtr0310203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSNIVCEWLRALGLAQYAESFLDNGYDDLEICKQVGDPDLDAIGVENPAHRHKLLKSI
RSLREKGAASVYFMLNDPNSLSGSMEILCETPPNNELELVLREQLETDGVRLTAHPYSTP
VSLAFNLY
Download sequence
Identical sequences A0A0B4KH49
NP_001262826.1.81976 FBpp0301887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]