SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0302531 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0302531
Domain Number 1 Region: 462-541
Classification Level Classification E-value
Superfamily Homeodomain-like 1.19e-20
Family SWIRM domain 0.00026
Further Details:      
 
Domain Number 2 Region: 80-133
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000895
Family ZZ domain 0.024
Further Details:      
 
Domain Number 3 Region: 136-187
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000217
Family Homeodomain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0302531   Gene: FBgn0263738   Transcript: FBtr0310380
Sequence length 547
Comment pep:known chromosome:BDGP5:3R:14078565:14081191:-1 gene:FBgn0263738 transcript:FBtr0310380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFMNPVDMVDEDAADLQFPKVEPLGPQVKRFIHAHQNEHTRNSMVLYNPHTLHRYLEEM
EEKTRDQNSSVPSATKDANRCATCRCSLTEPYIKCSECLDTLLCLQCFSRGKEAFSHRNN
HAYIIVRDNIQVFADEPHWTARDERILLKTLRTHGYGNWEAVSQALDQRHEPAEVRRHYH
DCYFGGIFERLLNLKHARDSYVPERMPYVFKMRSLDPPRHDDIASMQFRLSAGYRCARGD
FDTPYDTSAESLLSIMVDHRGRDDDNEASESEFEREVTEELQLGLVRAYNNRLRERQRRY
KIMRQHGLIMPNRTVSWISKYVHAFGSDASCMRFLGFMQICPDPIKFDMLLESLRYYREL
HSQLHKLYDLREHGVRTLSGAKLYARLSKERQQAQRDYSRLKQTDAFDWQQLVQHYESNR
SGDPGPLAINSKLYVMNTRRKASPIEIGGGKHFTHCLTPTEYNFSLIPDLPGYSKLDDGE
RKLCSVARLVPQSYLDYKNQLVTEQAKLGYLRLADARRLIKIDVNKTRQIYDFLLEHGHI
SRPPSYG
Download sequence
Identical sequences FBpp0302531 FBpp0083024 NP_001014635.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]