SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0302534 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0302534
Domain Number 1 Region: 452-536
Classification Level Classification E-value
Superfamily Homeodomain-like 8.36e-22
Family SWIRM domain 0.00017
Further Details:      
 
Domain Number 2 Region: 95-148
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000883
Family ZZ domain 0.024
Further Details:      
 
Domain Number 3 Region: 151-202
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000209
Family Homeodomain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0302534   Gene: FBgn0263738   Transcript: FBtr0310383
Sequence length 542
Comment pep:known chromosome:BDGP5:3R:14078565:14081191:-1 gene:FBgn0263738 transcript:FBtr0310383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFMNPVDMVDEDAADLQFPKVALLHIFTTLNCLFAVEPLGPQVKRFIHAHQNEHTRNSM
VLYNPHTLHRYLEEMEEKTRDQNSSVPSATKDANRCATCRCSLTEPYIKCSECLDTLLCL
QCFSRGKEAFSHRNNHAYIIVRDNIQVFADEPHWTARDERILLKTLRTHGYGNWEAVSQA
LDQRHEPAEVRRHYHDCYFGGIFERLLNLKHARDSYVPERMPYVFKMRSLDPPRHDDIAS
MQFRLSAGYRCARGDFDTPYDTSAESLLSIMVDHRGRDDDNEASESEFEREVTEELQLGL
VRAYNNRLRERQRRYKIMRQHGLIMPNRTVSWISKYVHAFGSDASCMRFLGFMQICPDPI
KFDMLLESLRYYRELHSQLHKLYDLREHGVRTLSGAKLYARLSKERQQAQRDYSRLKQTD
AFDWQQLVQHYESNRSGDPGPLAINSKLYVMNTRRKASPIEIGDLPGYSKLDDGERKLCS
VARLVPQSYLDYKNQLVTEQAKLGYLRLADARRLIKIDVNKTRQIYDFLLEHGHISRPPS
YG
Download sequence
Identical sequences NP_001014634.1.81976 FBpp0099664 FBpp0302534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]