SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0302614 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0302614
Domain Number 1 Region: 40-103
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000459
Family Variant RING domain 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0302614
Domain Number - Region: 125-288
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0209
Family ABC transporter transmembrane region 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0302614   Gene: FBgn0029661   Transcript: FBtr0310466
Sequence length 386
Comment pep:known chromosome:BDGP5:X:3356503:3358077:-1 gene:FBgn0029661 transcript:FBtr0310466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSNQEIYFQPRCMSDHMEMRGSGGSNPLSQHSELSNADGERICWICFATSEDNPHAHWV
QPCQCRGDTKWVHQSCLYRWIDEKQLGDRRQTVICQQCQTEYIMVFPQMNPIARVLEKLD
YAVRRICPFLVLGMFLCCIYWIALTYGAFTIIQVVGQDRAMQLMENKVILLVGLPFIPVG
LILFRLVRWKDAVLKAMRSIYIYIPRKLPFFHRTNQSEGASRDLGDLGDLDDLSVSSSSS
ISLPPIQHNPSITEPFYISRLICGAFFLPTFATTVGNVFFGRLDDALQRTILGGIAYIGI
KGLLKMYLDQKLYLRRLGRCILNYTDENVRMIDQHTQDNSNYNPNQGSNDDDRQFAGFNE
SIDDSFSVHTTDSAVGDASSIQIVVQ
Download sequence
Identical sequences M9PDP1
FBpp0302614 NP_001259211.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]