SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0302955 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0302955
Domain Number 1 Region: 1698-1783
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.48e-17
Family Tudor domain 0.012
Further Details:      
 
Domain Number 2 Region: 553-649
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000445
Family Tudor domain 0.011
Further Details:      
 
Domain Number 3 Region: 1326-1404
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000000379
Family Tudor domain 0.011
Further Details:      
 
Domain Number 4 Region: 769-860
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000248
Family Tudor domain 0.014
Further Details:      
 
Domain Number 5 Region: 1002-1108
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000323
Family Tudor domain 0.027
Further Details:      
 
Domain Number 6 Region: 204-262
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000033
Family B-box zinc-binding domain 0.0058
Further Details:      
 
Weak hits

Sequence:  FBpp0302955
Domain Number - Region: 26-80
Classification Level Classification E-value
Superfamily RING/U-box 0.000593
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0302955   Gene: FBgn0263974   Transcript: FBtr0329922
Sequence length 1857
Comment pep:known chromosome:BDGP5:3R:14416749:14475859:1 gene:FBgn0263974 transcript:FBtr0329922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIADDSGIKPFDPKFVASNLQNLLRCPKCSKCFTYLYNTNSEEDNHRPFLLGCGHTLCES
CLWNDRLDPKCAVCHSPAPPTIVAKRSDCKSVANLRDLYELNYHVLGRTSSLSYLLPFAK
DSANQSLSPSSISEIVQTVKCSECGNATASGECRQCNAFYCRRCFDAVHKRSRVLKSHIF
RNSTEQDSSFSKKLRVGDQYFTLPSQNLCIHHRMPKDKYCMKCYRSHCQICSTVHHSGHR
IRKLIEINQSYASEIPTTLNSLNMAHIHVLNGKQVVQRAKQKLNDYATETLASISKRFSH
LHGLLQVAELQVIEKLRESSLPPQLKLNEAMGQLSGYETVIERLTKSLNSGVGNDMAVPR
DVSLRWLLKLICEHLEKIPTTVQVSKVDENPYRVTCSRFMDISNIFKCEFVNPNIQVCFK
TDLEISRSLSSSPKGEITFLTSSSSSKENFDPHSRKLLLAQNSKLKKATQVSQSQKKRGK
NATEVAQSSLNSTAAIIDEFPAKDLDFLHNFSSLDITKRNKTTEDSSDWFKTDTLVRVRS
VQSPEDFYVQGIHAAQRLREELDTFAHTLSDSSSVPPTIVVGQNYIIHHKDKDRYYRALV
SQKLTNENLYNVFLTDIGVHLHVRCSDFRVVPERISHLPYSAVHCSLSELMPKNGESEWD
SKASAFLKQIVQNNPVRVIVKKALTYELHGVDLITSNYDTNISVRDSFLYCGLAISRDGA
PLWLPPAPTALRLPRISFRFGDVYMVQMLHVEDPQEFYVMRHDYEKKRLWLQFSLQEAMD
RINISQLQNIFLGQLHLGCVLQSGGQWKRASIEQILPDGYVLVHLVDEGPSQKVFWDQLF
VLPQKFWDTGLAIKCCLADVETRAEHSYTWTPEGTTLFKQLTSNPRLYMDVISCTEDLVY
VSLHFERSNSETTSVGVQLVAHGHCTSSGESSRMITPTVSNRSVRFDEETKKFIAQQKVR
PVELSPYRMPDNTERNKRTTVNILYVRKPDEFYVTLPHFQKAINNLQKSVQKAAAAMYQN
MLPRTDWQVGDMCYARVQANCDSQALWYRGVVTGVIPPGITCPIVRYQVHLRDLGELIDD
VHSSSLANIDEADMRISSSAKRCHLHGIRPIGDEWSKDAIDFFMDQLKAYNEIHVTGRGR
TENSLSVILWGSLSILTGPFSPATIKYVNINKALLMAGMAEKDHNSDSEDDQQSMPENVS
VNSEEAAKANDWESCLSKIDGTSKTNDSLNLIESRSVTVGFEHNEDMPPLALLEDLGNTK
NTTGETTPPAGWTTRRKCDKSVFTAIATNVTYECCIYLTLASDKPFIEHMGNLLVREYKP
LMDKQKERSTSYTYKVGQAVVVTYHMDNMIYRGIVQRLENNHNEYTVYYVDYGNMELVKA
DEMLPYAPFPDLNAMCFLVELHGVRSKQGKYSLKEMDTVHLNLVMKLSGVRIVDDETVGP
NKIPKCQIKVGNVDIATMMIDSGMSVPIEKQTIKNNTKYLPSQKFLEDFKVFDELDHLAA
GEGELSDKEAPPTQRKHDSISSVQQPPTKKFLVDQEEVEAFECDQDFDCQQAAQKMHLNN
NFYLGDFGKYADETTARDEDEPHSNSSKSIDMEVFANVNDSQLEPLNSFATEQLIRRIAL
RQQEIKDSITFSPIDTSSVRSFYDASASFKTLSLPNGVKEFYCTVDNVLSDTELQIAPCL
SEFTKHEISLIQETSTLIKDAEPLMEPKVGDLCLARYSRDKQWYRANIKEISPILSPTSE
QVTVFYIDFHDTEKVSFNHLKVMPSQLFMFPLRSFCVKLHGIKRNKSFKEKSVRQALQAC
LCQHPLVFARVHYPLNYYPNRPNCDADLIEVELYENRHEKKLVYQSLCENWMFLKKS
Download sequence
Identical sequences Q9VE55
NP_650735.3.81976 FBpp0302955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]