SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0302973 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0302973
Domain Number 1 Region: 986-1054
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000248
Family SAM (sterile alpha motif) domain 0.03
Further Details:      
 
Domain Number 2 Region: 897-973
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000973
Family SAM (sterile alpha motif) domain 0.031
Further Details:      
 
Domain Number 3 Region: 1069-1107
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000808
Family SAM (sterile alpha motif) domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0302973   Gene: FBgn0046704   Transcript: FBtr0329941
Sequence length 1158
Comment pep:known chromosome:BDGP5:2L:6723903:6732766:1 gene:FBgn0046704 transcript:FBtr0329941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWNMMCDVMPTISEDSISQRSSQFSGEDANFEQLMVSMLDERDKLMDSLREAQERLNETE
NKLRDVEKERDSLQRQINANLPQEFATLTKELTQARETLLERDEEIGELKAERNNTRLLL
EHLECLVSRHERSLRMTVVKRQAAAQSGVSSEVEVLKALKSLFEHHKALDEKVRERLRLS
IEKNNMMEEELSSAKEELAQYKAGVVPAGVGSGSGAGSAATTAGGGGAENGLKEKMAGVG
GSGGVNGEANELNDYAAKTHELQTIIEKQTSELSQWQRRVSDLNNKISELEENMSRVQKE
HCKAQDQCAKLQRDLRENVAQKEDQEERITTLEKRYLNAQRESTSLHDLNEKLEQELRHK
EAQLKAQERHGSAEDRIRGLETNLDEKTNEVVRLNQRLKMNEEHNLRLSSTVDKLLSESN
ERLQVHLKERMHALDEKNALTQELEKARKVAEELHHEKSEIMKELSKTRLEIENFKRQLL
QQEIAYNIQQTEALTRSLSPSSVVDPSGAFSRSNSHASFETHSLRRQSKQRLSEENALVR
SMAEQEWEKLQQAAHAQQQAYELASAADCDDSDVLYAAATDMMSPSGHTDAQTLAMMLQE
QLDAINNEIRLIQEEKQSTEARAEELESRVGSLEHVNLLARGRSMDRQSPPMSGRSTPNS
PQRDFMQKYHTLNLPVLSSDASREELHGGMSTTGDSSSGGAASPLTARSMRLERVAQALA
HSQEELRRRSIGLNPNASVAPNHTGGHMPLSSHSYGLSPLSSRYGSQESLRHYNTMGSMS
MLQTPTSGVSREAAAAAVQKKKGIKSSLGRFFSKKEKVKGVKDTLPDGSPSMMSIGNLSI
GLSEVDSNYDAMSMTGGMMPRIASSQGSKISSVDYGRQKKEHDYRNDLLGEAMKAGTPFA
LWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRL
AIQEMVSLTSPSAPQTSRTTLAFGDMNHEWIGNYWLPGLGLPQYRTTFMECLVDARMLDH
LTKKDLRGQLKMVDSFHRTSLQYGISMLKRLNYDRTELEHRRKMSENGLCDVLVWSNERV
IRWVGSIGLKEYANNLLESGVHGGLMALDEGFDANAMGLALQIPTQNAQARQILDTEFNN
LLQIATDRRPENEQRSAS
Download sequence
Identical sequences M9PC73
FBpp0302973 NP_001260153.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]