SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0302974 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0302974
Domain Number 1 Region: 1033-1101
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000265
Family SAM (sterile alpha motif) domain 0.03
Further Details:      
 
Domain Number 2 Region: 944-1020
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000103
Family SAM (sterile alpha motif) domain 0.031
Further Details:      
 
Domain Number 3 Region: 251-446
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000036
Family Tropomyosin 0.0023
Further Details:      
 
Domain Number 4 Region: 1116-1154
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000853
Family SAM (sterile alpha motif) domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0302974   Gene: FBgn0046704   Transcript: FBtr0329942
Sequence length 1205
Comment pep:known chromosome:BDGP5:2L:6723903:6731600:1 gene:FBgn0046704 transcript:FBtr0329942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWNMMCDVMPTISEDSISQRSSQFSGEDANFEQLMVSMLDERDKLMDSLREAQERLNETE
NKLRDVEKERDSLQRQINANLPQEFATLTKELTQARETLLERDEEIGELKAERNNTRLLL
EHLECLVSRHERSLRMTVVKRQAAAQSGVSSEVEVLKALKSLFEHHKALDEKVRERLRLS
IEKNNMMEEELSSAKEELAQYKAGVVPAGVGSGSGAGSAATTAGGGGAENGLKEKMAGVG
GSGGVNGEANELNDYAAKTHELQTIIEKQTSELSQWQRRVSDLNNKISELEENMSRVQKE
HCKAQDQCAKLQRDLRENVAQKEDQEERITTLEKRYLNAQRESTSLHDLNEKLEQELRHK
EAQLKLHEEKIGAIEEKLELSEQKLAQHAKLQPDMEEQLKARMEALTKVGNKAQERHGSA
EDRIRGLETNLDEKTNEVVRLNQRLKMNEEHNLRLSSTVDKLLSESNERLQVHLKERMHA
LDEKNALTQELEKARKVAEELHHEKSEIMKELSKTRLEIENFKRQLLQQEIAYNIQQTEA
LTRSLSPSSVVDPSGAFSRSNSHASFETHSLRRQSKQRLSEENALVRSMAEQEWEKLQQA
AHAQQQAYELASAADCDDSDVLYAAATDMMSPSGHTDAQTLAMMLQEQLDAINNEIRLIQ
EEKQSTEARAEELESRVGSLEHVNLLARGRSMDRQSPPMSGRSTPNSPQRDFMQKYHTLN
LPVLSSDASREELHGGMSTTGDSSSGGAASPLTARSMRLERVAQALAHSQEELRRRSIGL
NPNASVAPNHTGGHMPLSSHSYGLSPLSSRYGSQESLRHYNTMGSMSMLQTPTSGVSREA
AAAAVQKKKGIKSSLGRFFSKKEKVKGVKDTLPDGSPSMMSIGNLSIGLSEVDSNYDAMS
MTGGMMPRIASSQGSKISSVDYGRQKKEHDYRNDLLGEAMKAGTPFALWNGPTIVAWLEL
WVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSA
PQTSRTTLAFGDMNHEWIGNYWLPGLGLPQYRTTFMECLVDARMLDHLTKKDLRGQLKMV
DSFHRTSLQYGISMLKRLNYDRTELEHRRKMSENGLCDVLVWSNERVIRWVGSIGLKEYA
NNLLESGVHGGLMALDEGFDANAMGLALQIPTQNAQARQILDTEFNNLLQIATDRRPENE
QRSAS
Download sequence
Identical sequences M9PCR7
NP_001260154.1.81976 FBpp0302974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]