SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0302975 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0302975
Domain Number 1 Region: 1029-1097
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000265
Family SAM (sterile alpha motif) domain 0.03
Further Details:      
 
Domain Number 2 Region: 940-1016
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000103
Family SAM (sterile alpha motif) domain 0.031
Further Details:      
 
Domain Number 3 Region: 1112-1150
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000853
Family SAM (sterile alpha motif) domain 0.067
Further Details:      
 
Domain Number 4 Region: 257-517
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000105
Family Tropomyosin 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0302975   Gene: FBgn0046704   Transcript: FBtr0329943
Sequence length 1214
Comment pep:known chromosome:BDGP5:2L:6723903:6731345:1 gene:FBgn0046704 transcript:FBtr0329943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWNMMCDVMPTISEDSISQRSSQFSGEDANFEQLMVSMLDERDKLMDSLREAQERLNETE
NKLRDVEKERDSLQRQINANLPQEFATLTKELTQARETLLERDEEIGELKAERNNTRLLL
EHLECLVSRHERSLRMTVVKRQAAAQSGVSSEVEVLKALKSLFEHHKALDEKVRERLRLS
IEKNNMMEEELSSAKEELAQYKAGVVPAGVGSGSGAGSAATTAGGGGAENGLKEKMAGVG
GSGGVNGEANELNDYAAKTHELQTIIEKQTSELSQWQRRVSDLNNKISELEENMSRVQKE
HCKAQDQCAKLQRDLRENVAQKEDQEERITTLEKRYLNAQRESTSLHDLNEKLEQELRHK
EAQLKLHEEKIGAIEEKLELSEQKLAQHAKLQPDMEEQLKARMEALTKAQERHGSAEDRI
RGLETNLDEKTNEVVRLNQRLKMNEEHNLRLSSTVDKLLSESNERLQVHLKERMHALDEK
NALTQELEKARKVAEELHHEKSEIMKELSKTRLEIENFKRQLLQQEIAYNIQQTEALTRS
LSPSSVVDPSGAFSRSNSHASFETHSLRRQSKQRLSEENALVRSMAEQEWEKLQQAAHAQ
QQAYELASAADCDDSDVLYAAATDMMSPSGHTDAQTLAMMLQEQLDAINNEIRLIQEEKQ
STEARAEELESRVGSLEHVNLLARGRSMDRQSPPMSGRSTPNSPQRDFMQKYHTLNLPVL
SSDASREELHGGMSTTGDSSSGGAASPLTARSMRLERVAQALAHSQEELRRRSIGLNPNA
SVAPNHTGGHMPLSSHSYGLSPLSSRYGSQESLRHYNTMGSMSMLQTPTSGVSREAAAAA
VQKKKGIKSSLGRFFSKKEKVKGVKDTLPDGSPSMMSIGNLSIGLSEVDSNYDAMSMTGG
MMPRIASSQGSKISSVDYGRQKKEHDYRNDLLGEAMKAGTPFALWNGPTIVAWLELWVGM
PAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPQTS
RTTLAFGDMNHEWIGNYWLPGLGLPQYRTTFMECLVDARMLDHLTKKDLRGQLKMVDSFH
RTSLQYGISMLKRLNYDRTELEHRRKMSENGLCDVLVWSNERVIRWVGSIGLKEYANNLL
ESGVHGGLMALDEGFDANAMGLALQIPTQNAQARQILDTEFNNLLQIATDRRPENEQRSA
SXCSYSPPTSSVDE
Download sequence
Identical sequences M9PCD4
NP_001260155.1.81976 FBpp0302975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]