SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303042 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303042
Domain Number 1 Region: 286-520
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.28e-20
Family FCH domain 0.035
Further Details:      
 
Domain Number 2 Region: 699-756
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000942
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303042   Gene: FBgn0263980   Transcript: FBtr0330007
Sequence length 818
Comment pep:known chromosome:BDGP5:2R:11288601:11351351:1 gene:FBgn0263980 transcript:FBtr0330007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGISAHAAPASFWNHPRRIRRTPTSDRDGVDQCRPWICRRKDRRPAHPAANRPPESRVCG
PSSTFRWDDWAAPAPRTRERATDCARMCMCTSRIPYSVARICARTTSMHSSRPASRSSSF
IRRPLTRRQRMAVGGVTRRLWRTMRVYTIHQGRGVRRARAAQAVAAYLRDRRARIGKGWP
AQGHGVRISATEQWADKPVVRRPGDPTRRVAAGAVPVLAERLPKVTGSSVKSSSGRRSRR
RRIFGWRGPRGGSLSPQGGSMASYNGVLKDYSHSSLNEAFKSQNNVNFKLIKTVSDFSET
LSRLYEEHATALQVAVSNYRKKNAELRKERPACHLAIFQAWETFLQEVETDSQACNDVAS
VLSRQVSRPMLDKSFHRKVQSRKIFTHRESFETIIAKTEEKLSKCRVDYKQCHLAHRQNP
SQHSLTEYIDAHNAYVQQLHATNGMLEAYHTDTLPQQMQELEEIHNDLVAIVSDSLMQGA
EVIAGKANDQAKRYNSLSNQCAAVSPQQDLVNFVRLLAQPSQAQKIPRRLFASPQAEVGE
EAGDHNEMTPCLRNELVFDRHSTLSQRSALESLKREAIELELQIRQLQDSIEALNRTQTR
GIEGQLYNKVNELQEDLSMKKFDLRAKQIHLAAIRAQKDLFVSKVEPTSPRNERKFSAAT
APSMKTKWLKAFKSLKPAGSGSAQQADRRNGASSTASEPLRPNLDGSHHLQEYTYKKITA
CDVCSQILRGHTRQGLRCRICKLNAHGDCAPNLPRCQPKQKLLRRQKSTSELENRVDIEE
ETSANPKSETTRPFGEPLMLLKSTESNPDESKGNRRVR
Download sequence
Identical sequences Q1EC92
NP_001097322.1.81976 FBpp0111499 FBpp0303042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]