SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303046 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303046
Domain Number 1 Region: 286-520
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.26e-19
Family FCH domain 0.035
Further Details:      
 
Domain Number 2 Region: 1045-1109
Classification Level Classification E-value
Superfamily SH3-domain 1.04e-17
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 718-775
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000123
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303046   Gene: FBgn0263980   Transcript: FBtr0330011
Sequence length 1166
Comment pep:known chromosome:BDGP5:2R:11288601:11358596:1 gene:FBgn0263980 transcript:FBtr0330011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGISAHAAPASFWNHPRRIRRTPTSDRDGVDQCRPWICRRKDRRPAHPAANRPPESRVCG
PSSTFRWDDWAAPAPRTRERATDCARMCMCTSRIPYSVARICARTTSMHSSRPASRSSSF
IRRPLTRRQRMAVGGVTRRLWRTMRVYTIHQGRGVRRARAAQAVAAYLRDRRARIGKGWP
AQGHGVRISATEQWADKPVVRRPGDPTRRVAAGAVPVLAERLPKVTGSSVKSSSGRRSRR
RRIFGWRGPRGGSLSPQGGSMASYNGVLKDYSHSSLNEAFKSQNNVNFKLIKTVSDFSET
LSRLYEEHATALQVAVSNYRKKNAELRKERPACHLAIFQAWETFLQEVETDSQACNDVAS
VLSRQVSRPMLDKSFHRKVQSRKIFTHRESFETIIAKTEEKLSKCRVDYKQCHLAHRQNP
SQHSLTEYIDAHNAYVQQLHATNGMLEAYHTDTLPQQMQELEEIHNDLVAIVSDSLMQGA
EVIAGKANDQAKRYNSLSNQCAAVSPQQDLVNFVRLLAQPSQAQKIPRRLFASPQAEVGE
EAGDHNEMTPCLRNELVFDRHSTLSQRSALESLKREAIELELQIRQLQDSIEALNRTQTR
GIEGQLYNKVNELQEDLSMKKFDLRAKQIHLAAIRAQKDLFVSKVEPTSPRNERKFSAAT
APSMKTKWLKAFKSLKPAGSGSAQQADSQPPRQNQMYHAVSTVLTLRRNGASSTASEPLR
PNLDGSHHLQEYTYKKITACDVCSQILRGHTRQGLRCRICKLNAHGDCAPNLPRCQPKQK
LLRRQKSTSELENRVDIEEETGADKSVQAKQMDGSVAGGSALPVPVLSERELGRAPPPDI
PIVSVSELALQEQQQQQQQQQQQHQQQQRSLASVAQAAAVRAGRGVRPPPVAMPILGVQL
QQQELQQQRGGLPVPSQDISSSSAPHSPRRQKLNLRMKSLSLDSPESSELHGQFRRRTQL
PGTGASTSAGSGYYHGGSGGHLEHSTPPSNNSRLHSPSSPSHPGRKLLYATRGMRGGSVD
LPDEMEKSQSSASTSPCLSPKTHRLLPTNLYVIIYNFKARHADELDLKAGYKVTVIDNSD
PDWWKGKVLGRVGYFPSKYCVRLNANEKPLQVTHNLQVSDSERGENLTLLRDQIVIQTGD
EVNGMVMIRAAEHGQGYCPIKYLQEV
Download sequence
Identical sequences A0A0B4KG20
FBpp0303046 NP_001260994.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]