SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303047 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303047
Domain Number 1 Region: 286-520
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.72e-19
Family FCH domain 0.035
Further Details:      
 
Domain Number 2 Region: 1045-1109
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-17
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 718-775
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000239
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0068
Further Details:      
 
Weak hits

Sequence:  FBpp0303047
Domain Number - Region: 1122-1186
Classification Level Classification E-value
Superfamily SH3-domain 0.0233
Family SH3-domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303047   Gene: FBgn0263980   Transcript: FBtr0330012
Sequence length 1951
Comment pep:known chromosome:BDGP5:2R:11288601:11358596:1 gene:FBgn0263980 transcript:FBtr0330012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGISAHAAPASFWNHPRRIRRTPTSDRDGVDQCRPWICRRKDRRPAHPAANRPPESRVCG
PSSTFRWDDWAAPAPRTRERATDCARMCMCTSRIPYSVARICARTTSMHSSRPASRSSSF
IRRPLTRRQRMAVGGVTRRLWRTMRVYTIHQGRGVRRARAAQAVAAYLRDRRARIGKGWP
AQGHGVRISATEQWADKPVVRRPGDPTRRVAAGAVPVLAERLPKVTGSSVKSSSGRRSRR
RRIFGWRGPRGGSLSPQGGSMASYNGVLKDYSHSSLNEAFKSQNNVNFKLIKTVSDFSET
LSRLYEEHATALQVAVSNYRKKNAELRKERPACHLAIFQAWETFLQEVETDSQACNDVAS
VLSRQVSRPMLDKSFHRKVQSRKIFTHRESFETIIAKTEEKLSKCRVDYKQCHLAHRQNP
SQHSLTEYIDAHNAYVQQLHATNGMLEAYHTDTLPQQMQELEEIHNDLVAIVSDSLMQGA
EVIAGKANDQAKRYNSLSNQCAAVSPQQDLVNFVRLLAQPSQAQKIPRRLFASPQAEVGE
EAGDHNEMTPCLRNELVFDRHSTLSQRSALESLKREAIELELQIRQLQDSIEALNRTQTR
GIEGQLYNKVNELQEDLSMKKFDLRAKQIHLAAIRAQKDLFVSKVEPTSPRNERKFSAAT
APSMKTKWLKAFKSLKPAGSGSAQQADSQPPRQNQMYHAVSTVLTLRRNGASSTASEPLR
PNLDGSHHLQEYTYKKITACDVCSQILRGHTRQGLRCRICKLNAHGDCAPNLPRCQPKQK
LLRRQKSTSELENRVDIEEETGADKSVQAKQMDGSVAGGSALPVPVLSERELGRAPPPDI
PIVSVSELALQEQQQQQQQQQQQHQQQQRSLASVAQAAAVRAGRGVRPPPVAMPILGVQL
QQQELQQQRGGLPVPSQDISSSSAPHSPRRQKLNLRMKSLSLDSPESSELHGQFRRRTQL
PGTGASTSAGSGYYHGGSGGHLEHSTPPSNNSRLHSPSSPSHPGRKLLYATRGMRGGSVD
LPDEMEKSQSSASTSPCLSPKTHRLLPTNLYVIIYNFKARHADELDLKAGYKVTVIDNSD
PDWWKGKVLGRVGYFPSKYCVRLNANEKPLQVTHNLQVSDSERGENLTLLRDQIVIQTGD
EVNGMVMIRAAEHGQGYCPIKYLQEVXQPEEDEPPSDERDRPHKSSMQTSSSRTADKTKR
RIRIVVSENHNVAASSVAPAPPTTAFNTTTHHQIPRESDIETKRLNIDYGDEGSADWDKD
REVLILSGRRNKNDKNWENWERIREQKLEKMKGICFESYRQSKRDKLLQAKPRPKQLDST
WYTDNIYSNRSDDMDEDYVPDCLKYGPFRTLRDIHELDEKSGVTEERRVEGEGSPGYGLH
RSKSCKEFQYPKSQSWCFEGNVFEAGGGVASGSGSSSGAPPPTTSILKNRAGVPKSYSFS
ATTKTMPFDIIDYELPPVSNTRREKKEALRRNMNALCSSSLDRCCARDQCTSARCLLEDI
YPGSRMRPRTTGAGSNRNLSAADWLFEERAGRQRTPAAPTVICCCSAAEDCCCHRQRQQQ
PPLPARPRSRPLCPGHHPAAEEEEHMHCRYDTDLEHFIRAERERLMLQDKFLDDDERYLA
AAPAPRSPGRRYPAGNYHRPPRSKSLLEMQPPTILYDEDTCSDTTEIDLEDFNIDLEKYW
EQLDKPPSPINMDMRRNMHSSLKVKNVNVRCYNNGQPIDLHDREHERLMIKKSLLEGMPS
PPQLDSSESSTNAGGYPFFDTAPAVAPAPAFHHHPAYGQPQGYGHKVYPTVDTLPSYQYN
NFYPEHSHPTVGSVLTQQPTAGIHHPSAGGHSALSLINNIFSIYKPNKYSPENCQMNYES
KPEPCKKMNVPSTHRPLGAAAHPYPAHDYMHSSMKRPLLVSADQPHFKIIPEKTGLKISP
LLSYEDYGGGGGGEKAHHRLTSTARPLMLPH
Download sequence
Identical sequences A0A0B4KFR2
FBpp0303047 NP_001260995.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]