SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303076 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303076
Domain Number 1 Region: 953-1073
Classification Level Classification E-value
Superfamily Bromodomain 1.03e-21
Family Bromodomain 0.00075
Further Details:      
 
Domain Number 2 Region: 236-292
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000687
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Domain Number 3 Region: 888-948
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000142
Family PHD domain 0.0055
Further Details:      
 
Domain Number 4 Region: 82-133
Classification Level Classification E-value
Superfamily RING/U-box 0.00001
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  FBpp0303076
Domain Number - Region: 184-227
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0732
Family B-box zinc-binding domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303076   Gene: FBgn0023097   Transcript: FBtr0330043
Sequence length 1207
Comment pep:known chromosome:BDGP5:3R:16418881:16438262:1 gene:FBgn0023097 transcript:FBtr0330043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMDLEQLKNDFLPLIAGIKQEQLDAVPTDALPQMSTPNTASGAPTTSSLSSSSLSLSNP
CDSAEKRSESNSSASAKFTLFKCVYCAQLLGSNDRPKLLECLHVACAQCVSTKFSELDRS
LPPLIHCPVCDNASQQEFIVDNQFLIEQCTAGDSGDGVGLLGLTGEGQKSSAAASIQCSS
CSDGAVATSWCVDCSEYICDSCVQAHQRLKITKDHTIKPKDEANNEQLAGAAGVDKLHMC
QLHPQEKLSLFCETCDKLTCRDCQLSDHRDHKYKFAHEIATESRQALSTLVSEINYKRFL
LSSATKVIDDRQQLIHDKKKDLIKEITAMAVKITNTVNTRGKQLIMRLNEVCDSKLKVLV
EKKETLQLLSDNTDHCIDFMQNALEKGSDFAILSSKKSLVRHLQKLKCQRADIPNPEIPV
RIQVQLNQVSDLQKVISQLGIIIVDGKPYPPTPSPNGTPQPQHPPRQPPSPNMAPPLRPG
LPPGMPAGLSPNGPPVNFGPQNGPPLYSNAAQQQFNNLSMSRSFPGDGSGKVRFGGMPPV
GMQRHGQPHVSSSTHPQNMDISLRGLLNNQAAQSPNAHMAFNGPPSYPGGPQGAPAPAHQ
PMGPQMRPHFMPGQQGFSQGGGPGGGPRDANFMNSNARFQSQYQRMANHAQQAAAAAAMA
GAAGGGGGQIPSPGALQRPQMMSNPMQNVSAMQNSLGFHGSQAGFNTGPPQTSPQLGGGG
MHSLAKWHIPQSAQQSNMCSQQGPLLPFANGRQTSENFKISLKSPNTLKNSTPPSLGGGG
AGHQGHGNGSSSAQLNAAALGLGPAVSILSNVTSTNPKTPSPSTHENTKDFTEPIDKVRD
DSINDLIATIAKLDSNGVQVLPEGRTKTTSPQVHSSTDLSNTQEVNNKNEQKDDPNEDWC
AVCLDGGELMCCDKCPKVFHQNCHIPAISSLPDESESWQCLLCVNIKELTKTEGSEKSSS
GELSALELRILQRICLELYCQYEQSLNFREPESPANTSYYEIVSSPMSLDVIRTRLDPSS
PNHYKDIAGFVSDVRLIFSNTYLFYQEDTKTYSNAKYLENFFEEQLAKWLPQFEGTKPQG
KRNTSNSPALLGVNATGSPSPIENGRKSCGSASLGDSDGACLPAKRARRSAHEXNELMPG
GKGTDGEQQAETGQERRQEEQQQLPAFLEEMDLEMPQRPHSLGSSVIQESADYVLQLLHA
YAAAFGL
Download sequence
Identical sequences A0A0B4KGE5
FBpp0303076 NP_001262765.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]