SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303085 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303085
Domain Number 1 Region: 162-427
Classification Level Classification E-value
Superfamily L domain-like 1.62e-60
Family Internalin LRR domain 0.013
Further Details:      
 
Domain Number 2 Region: 363-621
Classification Level Classification E-value
Superfamily L domain-like 4.76e-48
Family Ngr ectodomain-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303085   Gene: FBgn0038504   Transcript: FBtr0330052
Sequence length 694
Comment pep:known chromosome:BDGP5:3R:13220921:13228237:-1 gene:FBgn0038504 transcript:FBtr0330052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLCSSGATASTTSLSSTGQAERSGGVPGGGAEGGGGSGNSGGGGKTSNGSAEAPTLCFA
GGSGTAGAIAGTEELSNANSPANGAGGATGSTGSGQQPTGSNGHSHLHNENNANMPPETR
PKMVTVKHPESNKPKPTTKKSKPIQADQDVIKALQRCRDEGIKRLDLSKSSITVIPSTVK
ECVHLTELYLYSNKIGQLPPEIGCLVSLRNLALNENSLTSLPESLQNCSQLKVLDLRHNK
LAEIPPVIYRLRSLTTLYLRFNRITAVADDLRQLVNLTMLSLRENKIRELGSAIGALVNL
TTLDVSHNHLEHLPEDIGNCVNLSALDLQHNELLDIPDSIGNLKSLVRLGMRYNRLSSVP
ATLKNCKSMDEFNVEGNGITQLPDGMLASLSGLTTITLSRNQFASYPTGGPAQFTNVYSI
NLEHNRIDKIPYGIFSRAKGLTKLNMKENMLTALPLDIGTWVNMVELNLATNALQKLPDD
IMNLQNLEILILSNNMLKKIPNTIGNLRKLRILDLEENRIEVLPHEIGLLHELQRLILQT
NQITMLPRSIGHLGNLTHLSVSENNLQFLPEEIGSLESLENLYINQNPGLEKLPFELALC
QNLKYLNIDKCPLSTIPPEIQAGGPSLVLQWLKMHSPYRQMXDVDGVWRTVYVGSDCYYQ
YELQTVNQAPGAGGNGGGGAAAAGGSASRSSDRR
Download sequence
Identical sequences A0A0B4KHA2
NP_001262665.1.81976 FBpp0303085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]