SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303133 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303133
Domain Number 1 Region: 276-380,506-667,700-833
Classification Level Classification E-value
Superfamily L domain-like 2.15e-49
Family Internalin LRR domain 0.016
Further Details:      
 
Domain Number 2 Region: 34-378
Classification Level Classification E-value
Superfamily L domain-like 1.29e-43
Family Internalin LRR domain 0.051
Further Details:      
 
Domain Number 3 Region: 845-1075,1102-1217
Classification Level Classification E-value
Superfamily L domain-like 1.98e-32
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 4 Region: 404-561
Classification Level Classification E-value
Superfamily L domain-like 6.8e-21
Family Ngr ectodomain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303133   Gene: FBgn0000313   Transcript: FBtr0330100
Sequence length 1305
Comment pep:known chromosome:BDGP5:3R:27029902:27036452:-1 gene:FBgn0000313 transcript:FBtr0330100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGYAFLTITLMIMIWMSLARASMFDREMEETHYPPCTYNVMCTCSKSSTDLGIVHCKNV
PFPALPRMVNQSKVFMLHMENTGLREIEPYFLQSTGMYRLKISGNHLTEIPDDAFTGLER
SLWELILPQNDLVEIPSKSLRHLQKLRHLDLGYNHITHIQHDSFRGLEDSLQTLILRENC
ISQLMSHSFSGLLILETLDLSGNNLFEIDPNVFVDGMPRLTRLLLTDNILSEIPYDALGP
LKSLRTLDISHNVIWSLSGNETYEIKASTKLNLDNLHLEYNHIEVLPPNSFKYFDTVNRT
FFDGNPIHTLREDAFKPARIREIYMRYCGLTNISPVAFDSLVNSLQILDLSGNNLTKLHH
KLFNNFDVLRVISMRDNKIKIQKPTETFNAVHYTLLKLDLSGDRNDPTNLQTLRKMRNMR
SLSISRLGSSSVGPEDFKDFGVELEDLQITRASLSGIQSHAFKHVRGLKRLDFSENGISS
IENDAFHEIGHSLISLKMSHGYSGSALPAEPLRHLTSLQELDFSNNHISSMSDTSFHFLK
NLRLLELHDNRIEQVLKGTFQGDIHSKLEEISLRFNHLTSISQHTFFDLEALRKLHLDDN
KIDKIERRAFMNLDELEYLSLRGNKINNLADESFQNLPKLEILDMAFNQLPNFNFDYFDQ
VGTLSNLNVNVSHNQIRQLMYNSSWSGRNEHGGMYHSNIKILDLSHNNISIIHPGYFRPA
EISLTHLHLGYNSLMNTTRDVFGNMPHLQWLDLSYNWIHELDFDAFKNTKQLQLVFFGHN
YLSDIPQDIFKPVQGLRIVDFSHNHLRGLPDNLFYNGGMEKLDVSHNMMLKIPSSSLSSL
AALTLCELHLSNNFISTIHSMDLSNKFRSLRYLDISYNYLLRIDDAVFATMPKLAVLDLS
HNRDLKVMDKSFMGLENSLIKLGLENISLSTVPEIRLKYLREFRLGYNELPSIPQELAHN
MSNLRMLDLSNNDLTNVPLMTQALPHLRRLMLSGNPITSLNNNSFDGVNEDLEMLDISNF
RLHYFEYGCLDSLPHLRSLKLTAYSHLEHFNIPHLLRHHYNIRQLWIEAPQPFTRIVKKG
SGPTQEMQTLQLGNPTDLQREMEGHLPSKLTNITFSGPQFTNLNERILRGMRSPYLYMQL
FNTSLQALPPNFFKYMGRVRNISLDIRYHNRNLKKIPNPNTGAVPYLPNSVFLTDLKMSH
TDLNCDCDLGWVEFWQRKRRQYICSSQTWTDTVFRTFMNSPCQVYGRHNCDEHDDDLRET
RCENKGGQQLMEALKFDLECGWDNANCREAAFVVVMVCVAMVFWM
Download sequence
Identical sequences A0A0B4KHG5
NP_001263136.1.81976 FBpp0303133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]