SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303178 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303178
Domain Number 1 Region: 890-998
Classification Level Classification E-value
Superfamily Bromodomain 2.09e-32
Family Bromodomain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303178   Gene: FBgn0261934   Transcript: FBtr0330145
Sequence length 3261
Comment pep:known chromosome:BDGP5:3L:6723262:6736264:-1 gene:FBgn0261934 transcript:FBtr0330145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSTFIGLLDIQSWWEIPCISHFCSLFSSAFDLPDIDIEDLESALLSDGTSDEDQVALVP
ELIVRLLKGCDALQTVAKEITHSNYQMFLRRFLRQQCRLHQTENHFDTDIDFQSLPVRKR
LHILHDLCHFRLDSVDVQVILSNLEADSLRVEPLGYDAKNSGYWYFYGTRLYREDKATGG
SASSSSGSGSGGAGASTGGASNSKGIGSNGTVWQVICFTEEDWQNLAAKFKTSTNAKERE
LFNILDDNFLPKLPQLFRERERLRRRKLLQVRNSSRIRNIAELKARQEEERQRRERENLY
QDRQNAHWLAPPQQQQQQQQQQQQQQQQSQQRTRRRSQSTSTASGISTYASSLRRTTTTN
SSEFLCHRETFCLSPENDEDDDDDDEALDAEQQSDQPEQQRQQEEQPPEEEQRQEPEELL
AVSATDDDFRSPEAPKSQTPAELKSKSSHHHHHHHHKKKKSSKKQKKRHHRDKGRERDRE
HHHHHRRRHKHASEADEGEDDNNNHNSNSNSNSNTNSISSNNSVQPKRRRSGQQQQHHQQ
AETTEPSTSLSPEDKENFCRQLQLLDTNSAAIAVATSIADLSLPSPVAHESETEQDEQVD
QPAVVEAQPPALTSAMAPAANVKLPGRQTNNSLSSLTGNIFIPSGSAQQQQQQSQEPPSS
SSSSQSGTTTTASTVRSKKQKAVLNSSGSSSTSKMADKADRNLSKTETTGKSKKSAAGSS
ASSSSSKAERISGAYSDKSGDDHVNSSNRSTTNNNSSLNNNNNHKHAPHHSHNNNNNSHS
TTTSATTTATTTTSQGYHYNSNLNHNQNHQNSHSHHTHHHHHHHHHTTNNHSNKHKTKSH
HSLAHNNNNNNSPTTNPTSTSLLHPVTTNNNSTYNSSNHANILSFTETEEVLQIGMHKVL
VYVKNHRDAWPFVDPVEEDIAPRYYSIIRRPMDLLKMEDKLDSGEYHKFSEFRNDFRLIV
NNCRLYNGHNNEYTEMVNNLQDAFEKATKKYFDNLSDDEDDDPNLSYPAADSKMNVFREK
YFSKKAKEETEKDAPGRPAVSSAEEDLSEIEAEAPQKAQKRKRKEKDKRRKKKTKSKADV
ETDDEDMEAEREPTPPPPPPTSKKSKTSKTGKEKEKDKEKEKDKDKEKDKETSSFKRGRK
TKSDKSASKSSKKTKKGAKKSSADSDPESDPSDSRESEDYSDDDHISLAKTKSLVKPTAR
TIAAQKKKSVPAESKVKMPTPVKRQVKGKGKGGRKAKDDSLDSDQSDVNVKKQLPPTAAA
ALAESAAELEEDPDDPPPDEDEDEDSSRSRSMSPFKVDLHKKYSKSALNDDLSELLTTVK
KVPTAETTKLSARHQDEADEERSSRESDGDFKSLSNSRGSSEERPPVAKKGKKAESSKKE
KEKKGRDKDRDRDKEKDKDKSRSAKDKKSKDESPVLVAAAEAAAVVQAELDMLLPFMDKY
DVIKYRRSRAAFSGSSASNSLAPSEDSKSAITKSNRENRKASAKREKSPDAVENKRGRKS
KDQKRSKESDKAEKSDKASKADTEKHSEKSKKKEEPPKVVEKAQREKSPAPVSALETIKE
PPAPTPIATSASGKVKEGPAKKEPKKRPDKQMPPPPKPADKSSEKGSGKKSSSKKAAQKA
GQPQTNNNTNLEALDVETEQTLKDINRWLEHTPRFTEFSSASNSPSRYNLLDDFDSGIGS
KLDAADFRRPVALAAPKAELVPTKLAEALNELVSEPKEAVSKSESESVAPTPSSVSSSCG
TPPHSMHSGNSIGSTSATAASSSNCSNNSMPTPLPVAVTPTPTPAPPPLLPIPKPKEPST
TQLILNPPPPPHIKQQLAKEAKRKSLKEKQAAQAAQAQQVKAKANVMRTIDRLQPGKAKG
NLLQNVVAVKSTEEGGDSHAGVNPVTTKVKELKNALITETCEGAPKLSLGTVLKTQDFSL
GKSLEEMSGKKDANEDDRPNEEASPKNSSPPTTPNTEAPKPFEALHELSKRGKSSEPSKS
EASQKEKPNLSAWLKAFGGPKVSKKSEDEEKQQTPVQDLQGDSKVAPPAHSPAGDNFSLP
TVMRQRKPSTGSTNSERSSFSQDPDSPRIAIDERYGSYAAGSYTSPIGASPIGASPIMVS
PKPNDDMGKPASPYPLNGAIKVGFYQDTTTKSSPDKSCSPREMNSPYPQYSQHIYSSASS
PNVSTPDMSGTSPYGGGNSYNPSGSEASKTPAYSSTSPLPIYDQYKQPRSQESDYNSSMS
PSTPNPHSPYQQPQSSPYTTPQQSQSTHPSPYHNQSPYHQQQHSPYHPPAAQQQQQSSQP
SHSPAAHQQALSPMHSVESPASSAATQPPTPLAQSPAEQQHSPYQQPVLSPYQQPQQQVQ
PPVVPPVQPSAGAQASTALGNNGYAPTHDSYQQLQQQQRSLYNPATLINPLSTAASSTAS
ITKPNNDWSLNRSLLPPSITNTVNQAAQQQQQQQQQQAGQLQQQPQMQAAQQQLQSTPQQ
QQQQLQGTPQQQQLQGSQQQQQQQQQQQQLQTSQQQQQQVLGHQQQHKPKYPTYAQYQST
NAAANAAAAADAVDNLQQQQQKIAPPTYGSDMATFMQHQMQQPPKTDTLINPLKRPGEEI
GMDYSGNAANKMQKREETPAQQQQQQQQQQPTQNQTQSLLNKQQQMFNSFLGTMAFGKPI
GNIAPDKAFEMYNRAAAMGFPKDFAKDNSCQLQQQQQQQQSPQVTTNKQQANQQTQQQPQ
QQSQQSQPHLTQLQTALSQNYQQQQQQTQAQKLPQQQQQQPPQQLNYQQQQAQLNHNYTA
QQQATAVPDKPPAAQSTVAAAVSESSSNMMNLPSTAHQHHLSQTHHLAAYNKPTPPPPQT
YSNPLMQSMLGYAGNYFDKTMPPAAHMYSASSSAASAYGNPAQQLPGNYVPGNNNPAHQQ
QQQPQQQQQQQQQAPAVPPAEVKAPAKRGRKKKAATIAAEAAAAAAKQQQQQQQQQQQQA
QQQQQVAAQQQHQQQQVSAQQQQQQHQQVAAQQQQHQAMPQYNMPQSMASAAAATNNQLQ
AHAQALQQGFQLYAGLKSGGVSSPVGSSAATPVNSGGSTTNQTAADAAAISLKTSTGGMV
PGSAFNFAPTPGTLGLYGDQAAAASSYLDQFRDAPNPYYMPPAPAHSGTAANPSGNAADK
GQNPLNTAAGSYPFLAAAHPSSRAAAAAAAYPFADPNSQLYQQYLRRDDFHTRMIFNQSL
LGGPAAAAAAAGYGQPPPPPSAYQRAALGMPKPYDINRQSWFXQYASAANVDLQGDDLTG
AATGTASGPAAASSSTAATQR
Download sequence
Identical sequences M9PEI6
FBpp0303178 NP_001261480.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]