SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303202 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303202
Domain Number 1 Region: 1169-1236
Classification Level Classification E-value
Superfamily RING/U-box 6.41e-20
Family RING finger domain, C3HC4 0.0036
Further Details:      
 
Weak hits

Sequence:  FBpp0303202
Domain Number - Region: 731-740
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0915
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303202   Gene: FBgn0037944   Transcript: FBtr0330169
Sequence length 1265
Comment pep:known chromosome:BDGP5:3R:7570205:7575186:-1 gene:FBgn0037944 transcript:FBtr0330169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLENDQEELHHQPRVTLAYGSVATSSGGQENHSQYAMYYNQQRDSEGYMLMTPFLSSS
QSHSHTRSPPTYTAMVEPRREESSGFEGLARRCDKCSSLDGLCRCESMVASSSRYADSTQ
NQSHSEAQFLEQPSSSTAAIANPPAVHSIPRPKRKKTEPLTMEPESDNDGDAVVASVSGT
WPAGAIEEHAMDSTAVVYEVPSSSLQLSNSSFETAPSAVNAYDDVTSSASDTEHGQFAHT
RTTNTTTTTSAVQAHKKKASRSNNASNTSSRAVDTDATPSTSAQSRKRQMSQFSYRKSRV
LEPENESSDDGWDLRVHNPVPPIEPTVTIIRGSRGSDEAEIGHTDHNYYNSRCAVAGAPP
DSTYIRSASCSTATHTTRSVDYGSRIGRRSAATGSPSTSSDQEQEQQQRQQQEEIIHEER
RHQQSPGQPMHSMYGVPGESRMSWSRARPSDDSVPPRKHARMELPGRSRSKLSSTNFNSF
YPGRRGHRTFAEQGNSSGQHHVRFPPSSTPNSNGPCVITYVGRPRDSQPAADLNLPSTST
GRRGSHETRADSVVLTAPDLQLDDWSSDDDDDDVVFVHSTREPILSIDLTSDDDGLANDT
QLQRDRDRGRERERERARDREPYRNDTQPNPEDPNEDRRTMYDCAYTFPYARRTDRRTEA
NNEGTSAFAFYSGALADRAAISDHNYSYELDQLMDPGPGNFYPPRCSNMDPQRYFLPINE
SSMWMPGHPAPPPPPPPMPPILLPDNSSTEAYLRHQQRNLTSTPSSSSSEQTSTQQSRHR
RSSPANVYHRYHPYYYAITTLPTVVESDYPPSLQPHPHPHPHFQPSQGGSSRSSLSGALN
AAAVAATAAAVQAQTFSDLLSQAHNEGRAAALEGNRTPPHTMVHAQHQQRQSINPPAPGV
ASNANLAAAVSPPPPLEMYSGRSTIPHCGSPPFSVRRSEAAYSNRQHYQPQPHQGHQAPQ
NQMHAHIHPPHRASAIVATSLTPAPPYPVHQNLWYRQQSMQEMHRRHMTPTPIDLSSNAP
LLTSTLRNGYLHSICSCVHARNGPVSSLDPAYYPPYDAAPAAAAPPPSPQQQSPATSGSG
NSSVAAQASMRHLQLQPQQQPQAQQSPPVMQHMQRQRAIHHHMFHHHYSPLHLEIGLAPL
SLGSRILIAPSRPNRGATLETIERNTLPHKYRRVRRPSETDEDAEKCAICLNLFEIENEV
RRLPCMHLFHTDCVDQWLVTNKHCPICRVDIETHMPNDALPPSSSGVPDAANSAALXHCV
HGIFM
Download sequence
Identical sequences A0A0B4KFN6
NP_001262484.1.81976 FBpp0303202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]