SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303262 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303262
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000233
Family First domain of FERM 0.0095
Further Details:      
 
Domain Number 2 Region: 92-157
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000131
Family Second domain of FERM 0.0055
Further Details:      
 
Domain Number 3 Region: 323-429
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000138
Family Third domain of FERM 0.021
Further Details:      
 
Weak hits

Sequence:  FBpp0303262
Domain Number - Region: 543-590
Classification Level Classification E-value
Superfamily RING/U-box 0.000165
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303262   Gene: FBgn0260866   Transcript: FBtr0330229
Sequence length 696
Comment pep:known chromosome:BDGP5:2R:18450657:18480473:-1 gene:FBgn0260866 transcript:FBtr0330229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCIVNLPNGTQQAVKWDPKANGQECLEKVCRAMNIICEMEYFGLEHWTPNQKESQTRQW
INLRNRLSGDSGSSGSGIQLMLALRVKFWVPVHFILQESVRNLFYMQARRDLLEGRLTAP
DWSGAAKLAALLCQADGLRFNESSLKADCPMRMRRELAQQQQQQQQQAQQHRLEQQRKEK
EHVLSFKKRRLSKQKSMEHIEVCTLPAASTTSCSLQPSPSASASASASASASASASTSAC
SQTHSNSSSSSPSNSSSQTGLDERLASNPLRVYEEYFMQPSCEGEPPADYLRQIAVEHGK
LAKLQMSLKTAKYWLLKSIQDLEGYGEELFSGVTTNESATRCDIAVGAHGITVCRGGEKQ
SIPFGAIAAAKSLRRTFKLEYVDDHNDRKELEIKLPKQPIAAGLYRSITERHAFYVCDKV
RGVVTNQFTRDLKGTIASMFMENTELGKRYVFDIQHTCREVHDQARRTLHERGGDLVAEG
AEGCSAVAGGLGASAVGEPGVSPWAMALTTGAGGSMAGKIDLAIREKEAREAAIERCVDT
RISEAMQCKICMDRAINTVFNPCCHVIACAQCAARCSNCPNCRVKITSVVKIYLPPELRT
SQTGSGATTTSSSSIMGDGQVEEQLLQQQLDEISAAPASLEAGADAGVGVGGMAVGAGAG
AGATGPGGQPKVTTAAXNWLCSLLFRLMEWVCVPIV
Download sequence
Identical sequences A0A0B4KFY0
NP_001261137.1.81976 FBpp0303262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]