SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303271 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303271
Domain Number 1 Region: 440-568,866-968,1010-1083
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.71e-52
Family Diacylglycerol kinase-like 0.0087
Further Details:      
 
Domain Number 2 Region: 7-97,164-191
Classification Level Classification E-value
Superfamily EF-hand 4.05e-32
Family EF-hand modules in multidomain proteins 0.027
Further Details:      
 
Domain Number 3 Region: 166-256
Classification Level Classification E-value
Superfamily EF-hand 1.66e-18
Family Calmodulin-like 0.018
Further Details:      
 
Domain Number 4 Region: 271-331
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0029
Further Details:      
 
Domain Number 5 Region: 340-398
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000103
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303271   Gene: FBgn0085390   Transcript: FBtr0330238
Sequence length 1139
Comment pep:known chromosome:BDGP5:2R:3723995:3773487:-1 gene:FBgn0085390 transcript:FBtr0330238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIGIAAPKWDKLSPREFLQLQELASYSTRKLQDVLREFSSPSAASTPKCIPDGDIDFDG
FRRFLDAFLDCEAPLDLAKHLFVSFLKPNVTQAQLHGRALNQMAAISSTAACAPVTSHTK
AVSRILPAIGRHCPGSLESGSAQAEKRADIKLLARKLSHFDPLTLKVPLKDVVCYLSLLE
AGRPEDKLEFMFRLYDTDSNGVLDTAEMDAIVNQMMAVAEYLGWDVSELRPILQEMMVEI
DYDADGTVSLDEWQRGGMTTIPLLVLLGVDSTTLKEDGIHVWRLKHFSKPAYCNLCLNML
VGLGKKGLCCVLCKYTVHERCVQHAPASCITTYVKSKKPKCGGDLLHHWVEGNCYGRCSK
CRKRIKAYHGITGLTCRWCHMMLHNRCASSVKKECTLGEYSELIVPPTAICPAVLDRQRS
VNQAHKATHFQITPPDELSCPLLVFVNPKSGGRQGDRILRKFQYMLNPRQVYDLSKGGPK
EGLTLFKDLPRFRVICCGGDGTVGWVLEAMDSIELASQPAIGVIPLGTGNDLARCLRWGG
GYEGENIPKLMDKFRRASTVMLDRWSIEVTNTPHSDDMRPKVTLHSNMQKVIELSQSVVV
DKSLMERFEEIQRQSKQVATSMGTAASSTSIMMASKTETEMETMATMEFGSSTTTTNRTT
TTKSISMSTFETQCLQQTLRTAMSSSSSNTSSGSPCNGNQDAETEVDSHAAAAADVREKS
VPRRSGETEKQSLETLLLQHKQQMQQQQQQQQQGVTSLAVEEAATATPVGSNQSDNSSQR
NKQNNILKQQITLSLDLSDHEDEPKDDGGGAGDGTKSNGNSIPATPATPITPTTPNAASS
VLQQQQQQHLQFEQQQKPIKVQSDKDCTVPYNIINNYFSVGVDAAICVKFHLEREKNPHK
FNSRMKNKLWYFEYATSETFAASCKNLHESIEIVCDGVALDLANGPHLQGVALLNIPYTH
GGSNLWGEHLSQKRIRKSAGPFGKSKKLRAGDKEFSATSFNSVDLSVAIQDFGDRLIEVI
GLENCLHMGQVRTGLRASGRRLAQCSEVIIKTKKTFPMQIDGEPWMQMPCTIKVTHKNQV
PMLMAPRSEKGRGFFNLLCSXFRRSASSDFMGRSAQESADELDDDFRIVPRSTTVHNIA
Download sequence
Identical sequences A0A0B4KEG4
NP_001260792.1.81976 FBpp0303271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]