SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303367 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303367
Domain Number 1 Region: 1114-1317
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-42
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 2 Region: 904-1116
Classification Level Classification E-value
Superfamily Fibronectin type III 6.5e-40
Family Fibronectin type III 0.00014
Further Details:      
 
Domain Number 3 Region: 1408-1590
Classification Level Classification E-value
Superfamily Fibronectin type III 7.86e-32
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 4 Region: 806-909
Classification Level Classification E-value
Superfamily Immunoglobulin 3.6e-20
Family I set domains 0.023
Further Details:      
 
Domain Number 5 Region: 422-526
Classification Level Classification E-value
Superfamily Immunoglobulin 9.37e-20
Family I set domains 0.0065
Further Details:      
 
Domain Number 6 Region: 524-613
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-19
Family I set domains 0.019
Further Details:      
 
Domain Number 7 Region: 608-711
Classification Level Classification E-value
Superfamily Immunoglobulin 4.5e-18
Family I set domains 0.022
Further Details:      
 
Domain Number 8 Region: 238-327
Classification Level Classification E-value
Superfamily Immunoglobulin 9.24e-16
Family I set domains 0.044
Further Details:      
 
Domain Number 9 Region: 1318-1413
Classification Level Classification E-value
Superfamily Immunoglobulin 9.82e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 10 Region: 702-802
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000113
Family I set domains 0.016
Further Details:      
 
Domain Number 11 Region: 324-416
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000641
Family I set domains 0.017
Further Details:      
 
Domain Number 12 Region: 30-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000394
Family I set domains 0.029
Further Details:      
 
Weak hits

Sequence:  FBpp0303367
Domain Number - Region: 138-227
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000664
Family I set domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303367   Gene: FBgn0263218   Transcript: FBtr0330335
Sequence length 2085
Comment pep:known chromosome:BDGP5:3L:7153404:7183017:-1 gene:FBgn0263218 transcript:FBtr0330335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWISSRFFVILLLLNLDNTCSEPFEAHLRGPGFVMEPPGRVEFSNSSGGWLDCSASGSPQ
PTVDWVHADGSAVTEIHGVRRVLRNGTLVLMPFAAAAYHQDVHNTIYRCIASNSVGRIVS
RDVQVRAVVAQAYKVDVEVLSAARGCTAILRCVVPTFVKELVRVVSWVHEPAIYIYPSLQ
GDGKFHLLPTGELLIHNLQESDESQSFRCRSMHRLTRQVVVSSPTRLRINSHRGIISPSV
VEHTAHVQVSQDEGAVLLCVAQGCPSPEYSWFTHNGAGPLPVLSGPRVRLLGPILAIEAV
TGEDSGVYKCTAGNVGGEASAELRLTVATPIQVEISPNVLSVHMGGTAEFRCLVTSNGSP
VGMQNILWYKDGRQLPSSGRVEDTLVVPRVSRENRGMYQCVVRRPEGDTFQATAELQLGD
APPVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVHGD
VISHVNISHVMVEDGGEYACIAENRAGRVQHAARLNIYGLPYIRLIPKVTAVSGETLNLK
CPVAGYPIEEIHWERGGRELPDDIRQRVQPDGSLTISPVQKNSDSGVYTCWARNKQGHSA
RRSGEVTVIVPPKLSPFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGRPIDPTQHM
SVKQVDQYNSILVIENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVEPVDANVE
RNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREG
FYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPINIVWM
RSGKNTLNPSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQL
QVQEPPLPPSVLEAAMISSRSVNIKWQPKTLGTGDVTKYIVEFREADHSLPPALFVDQWQ
QIEVKDPPHFNAMIENLKPATRYAFRVIAEGSAGRSAPSQELIVRTEPQRPAGPPLSLSA
RPLSSTELLISWVAPLPELRHGDIQGYNVGYKLSSSGNTAYNFTSVSGDGDGGNGELLLS
GLAKFARYTVVVQAFNQVGPGPLSEPTAAQTMEDVPSRPPEDVRCAALSSQSLQVSWQPP
PIYHTNGLLQGYKLIFEPIIDDIQPSKDEVESRKTTALTMVLTGLRKYTNYSIQVLAHTR
MGDGVVSKPLFCHSEEDVPEAPADIKVVSSSSQSLYISWLPPNEPNGVITKYSLYTRVVN
GREELNNEKRSLPSQQAYYEAKGLHPHMEYQFWVTASTRVGEGKSSRVSSQITTNRIPAR
IISFGGPVVRPWRSTVTLPCTAVGKPKREWFKSDVALRQGGLHNSQLLDSGDLIISSLQL
ADGGNYSCQVDNGIGTDRLTHTLIVQVPPTAPVLYVTSATSSSILMHWKCGFTGNAPITG
YTLFYRRANGNTDEMQLSRHASSHELKGLMCGSTYQIHLSAQNKVGTSPTSTILHVRTQG
QSPGHPASTALLAPNSTSLLVRLHSWPDNGCPLLYFVLQYRAVTDDPDAEWVLVSNALKP
QRRIVINNLQPSTLYQLRMEAHNVAGISQAEFNFVTLTKDGDPPPPEIMHRGRSGQTTVI
FANINLLIPTIAAVSGMFCTIIMIIVCYRHMLKNAPPLAEQSQIQKESLENRANSEAAQR
ERYYATIHKVSMQNNDKIPETSEDISPYATFQLSEAGGNMSQPHHGGPANTLLHSFMYHE
RALAEGCSSPPPAASKNRRRHSRKTEPESEESESDQDQLTSSRTESSNQHEGKIKHSIIY
HGAQSSTSSDLSPMSEQKSLPRRGRSRYHHQQYQFSTNTTPRHHNSNKMNNNTTSNTNTT
ATNTTATPSTSSNSNKILSPRGGNLKSISSTFKSQDSIQCHIPTLVKSPSISTQQQKQFH
KQQLQNSSTNNSQHSSSNPNSSSLKQQQPLLITPKLHQLEANGQELLGLDGIGNSPLVAC
MPPSSQFRPIPHKSIMPAHEPPHHHNHSQQSHPHQQQQQQQHPGTLLNPSTAMLSSKFFT
APTLPKXDTANGGSEYVGGAMEAMDGFGYDSGEISCTYMDPIDQT
Download sequence
Identical sequences M9PED2
NP_001261498.1.81976 FBpp0303367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]