SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303370 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303370
Domain Number 1 Region: 68-416
Classification Level Classification E-value
Superfamily L domain-like 1.62e-61
Family Internalin LRR domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303370   Gene: FBgn0085397   Transcript: FBtr0330338
Sequence length 738
Comment pep:known chromosome:BDGP5:2R:17770817:17833769:1 gene:FBgn0085397 transcript:FBtr0330338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDHTRVTATTRSRPWLCGAIPVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCV
DAALEDVPIQLNPETKYINLTVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQS
ELRTLNLSRNLVSSLHKHAFKGLTNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNI
VSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLK
ELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRF
SQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQTLHLNNNPQLSDIPMRLFQG
NPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQCNCSLLWLWRLVTGNFEGVDPG
MEHAAGGAVAALAKEADDEELADEATAVASTDDGVAALAAYIAEQHIVNALHTTEPSAYE
LATSSSNRNSGILRMDRQQIGCDIWRDKVRTRRKLLTMSEGEITCPAHIVTVVCAVITCL
LVAMIGISVLYYLRFVKRRRKLLHERGPMRTSKSIINVHDRILQGHNPGGLGLGMSMTLG
GGNHVNGLGMTLNYPHHAQTLQAHHHYHQAMPLQSHGGNGNHEYQQTTLPQLDKLELERY
LAAQTIANEYRALKPWELPVKEADDEPEHLYERFDHYEYPDTHTMSKLKQAASLNHSNSS
AGPSPVPPSSGKPHVVYV
Download sequence
Identical sequences Q5U1A7
FBpp0111505 FBpp0303370 7227.FBpp0111505 FBpp0111505 NP_001097402.1.81976 NP_611619.2.81976 FBpp0111505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]