SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303404 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303404
Domain Number 1 Region: 41-330
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.37e-60
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303404   Gene: FBgn0038948   Transcript: FBtr0330378
Sequence length 441
Comment pep:known chromosome:BDGP5:3R:18186504:18188255:-1 gene:FBgn0038948 transcript:FBtr0330378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEFKLPKRSRKRTREVKRKARPELDGENAWSAMRYCEKFEPFWDFTDNLERIEESQVP
ESEFIERFERPYKPVVIRGCTDGWLALEKWTLARLAKKYRNQKFKCGEDNEGYSVKMKMK
YYVEYMQSTRDDSPLYIFDSSFGEHHRRRKLLDDYVVPKYFRDDLFQYCGENRRPPYRWF
VMGPARSGTGIHIDPLGTSAWNTLIRGHKRWCLFPTQTPKELLKVTSAMGGKQRDEAITW
FSTIYPRTQLPSWPEQYRPIEVLQGAGETVFVPGGWWHVVLNMDDTIAITQNFSSQTNFP
CVWHKTVRGRPKLSRKWLRVLRDQRPELAQIADSINLNESTGFASDSSSNSSSSSSSSSS
SSEEEESDDGGDSNTDSGQESLTAKKKKKRRMAGGGSGSGSMGGSSRSXSRERAKRKGLL
MRLFQRQLMLLRGLPRRCRLS
Download sequence
Identical sequences A0A0B4KHW1
FBpp0303404 NP_001262832.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]