SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0303407 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0303407
Domain Number 1 Region: 6-66
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.79e-18
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 
Domain Number 2 Region: 736-803
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.75e-16
Family SAM (sterile alpha motif) domain 0.0025
Further Details:      
 
Domain Number 3 Region: 629-714
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000407
Family SH3-domain 0.0025
Further Details:      
 
Weak hits

Sequence:  FBpp0303407
Domain Number - Region: 152-211
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00549
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0303407   Gene: FBgn0051163   Transcript: FBtr0330381
Sequence length 1080
Comment pep:known chromosome:BDGP5:3R:17959557:18120654:1 gene:FBgn0051163 transcript:FBtr0330381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSNIVCEWLRALGLAQYAESFLDNGYDDLEICKQVGDPDLDAIGVENPAHRHKLLKSI
RSLREKGAASVYFMLNDPNSLSGSMEILCETPPNNELELVLREQLETDGVRLTAHPYSTP
PSSCLSDKEEDEIYGFGYGVFAPRVARGGLTQQQQLLQQQTLQTQQSIQQQQQQMQQQQQ
QLPIVPGQQQQGPHQHQTLPPNVAHLNFVQQNCLSPRSAYFYEFPPTAEGRETKKRTTLA
RLLKGLKTVNRRDRNNQQNGAQARAANDRLRHFQMINGGAGGQQHSFEETIHRLKVQEAM
RKKEKFQREHEEILRDIRQGLLQMSRGEGRMDDTYMYDEALRTGGGMGIAGLGMPLGVGG
NGGGGGAAHYAVSALHHQGHWYDEPPYESDPDDFLMAGLNCGPAATIQGGRVRFSNNRES
TGVISLRSAGDISLPQRGPPRRGLIVPQQPPNPPTIIPLTHARSHDRESGDYAGSISDLQ
SVTSRFSTVSIGTNNCTARYRTLSGGIGESPSLSPSPSSDYEDIGVTRGHGCLPPSLLAA
KAKKNGLPHGKANTICQKATVHHSGEMRSSAKEIGAFNENGRNFVATKDTSRDFSNSQDN
TDRGSMSDQAFACSASSVESLPSASGSSTQALVRPGSPHSSISAEDRTSMASCICKAKAL
VDSLPNPYDKEALKFKKGDLIDVLSMNASGIWKGRCHGRVGHFKFINVEVLPEQRMKNSS
SKTLAAGSRLANSGNGSHNGGPCSVEDLLIRIGLKEYTSVFVLNGYEDLELFKELEPADL
DYLGILNQEHRAKLLTAVQLLHDIECSDVDIPGSSSENDEARLNNINMKHGASPFGRRHF
PRDSGCYEGSPLPSSQTPTQAVNSTDESNSLDDVVTKCSSEIMKRVESARRCKDNPFKTT
LPGGGRLGKKSFLGGNGLMADDTLTRGGLSEKSSDSGVSSSSLSSGPLKSSTXHLPTILA
HELLLGVGSGMGMGLGLGTMSHGTTGTLTPHGVATATSPTAHSAPLGNICNTLPHAPSSS
GGGGVSSSMASNLPLNRNLVMLRNHLRKNTGGSITGNGGVGASGVGAQLLQDQDDRLEDQ
Download sequence
Identical sequences A0A0B4KHV7
NP_001262827.1.81976 FBpp0303407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]